SecReT6
Protein ID: 528986887
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051391
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5487924..5489270 [+]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDR4Y0Q3
KEGG IDaxo:NH44784_051391
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-129, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|528986887|ref|YP_008032204.1| Uncharacterized protein ImpJ/VasE [Achromobacter xylosoxidans NH44784-1996]
MSYSAKILWGEGLFLRPQHFQRQDAYHEARLAEMSRALHPYSWGLRAARFDAAALANGMLRATELSAIFP
DGEIYNAPHNDDLPPAVALDGLDGASEAVFYLALHPMKDIGGNYRDAQQAQGFDARYAHQDSPAPDLYTN
ASTAELAFLRKNVRLLSEHEPRDALLTVPVARVRRTASAGYELDTGFIAPSLTVQACGALFEQLRRLLDA
LQAKVNALYGFHREPNKNIIEFRSGDVASFWLLHTANEAYSALSHLFHNPQLHPERLFQEMLRLAGALMT
FSKVHTLADLPVYRHEQPGAAFAQLDTILRDLLDTVISTRYFSIVLEELRPSFHVGRLDSDKLDETTALY
LSVSAATPASELAETVPLRFKVGAPDDVEKLVLSAMPGVQLAYTPQVPPAVPVKPGACYFTLQTRGSLYD
RMLQARSIAIYAPSGIPELKLDLIAVTR
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|528981796|ref|NC_021285.1|:5487924-5489270 Achromobacter xylosoxidans NH44784-1996 complete genome
GTGAGTTATTCAGCGAAGATCCTGTGGGGAGAGGGCCTGTTCCTGCGGCCCCAGCATTTTCAGCGCCAGG
ACGCCTACCATGAGGCCCGCCTGGCGGAAATGAGCCGCGCGCTGCATCCGTATTCGTGGGGCCTGCGCGC
CGCGCGTTTCGACGCCGCCGCGCTCGCCAATGGCATGTTGCGCGCCACCGAACTGTCGGCGATCTTCCCC
GACGGCGAAATCTACAACGCGCCGCACAACGACGACCTGCCGCCCGCCGTGGCGCTGGACGGGCTGGACG
GCGCCAGCGAGGCCGTGTTCTACCTGGCCCTGCATCCGATGAAGGACATCGGCGGCAACTACCGCGACGC
GCAGCAGGCGCAGGGATTCGATGCCCGCTACGCGCACCAGGACAGCCCCGCCCCCGACCTCTACACCAAT
GCCAGCACCGCCGAACTGGCGTTCCTGCGCAAGAACGTGCGGCTGCTGTCCGAACACGAGCCGCGCGATG
CGCTGCTGACGGTCCCGGTGGCGCGCGTGCGCCGCACGGCCAGCGCCGGTTACGAGCTGGACACCGGCTT
CATCGCGCCCAGCCTCACGGTGCAGGCCTGCGGCGCGCTGTTCGAGCAGTTGCGCCGCCTGCTGGACGCG
CTGCAGGCCAAGGTCAATGCGCTGTACGGTTTCCATCGCGAGCCGAACAAGAACATCATCGAGTTCCGCT
CGGGCGACGTGGCCTCGTTCTGGCTGCTGCACACCGCCAACGAAGCCTATTCGGCGCTGTCGCACCTGTT
CCACAACCCGCAGCTGCATCCGGAACGCCTGTTCCAGGAGATGCTGCGGCTGGCCGGCGCGCTGATGACG
TTCTCGAAGGTGCACACGCTGGCCGACCTGCCGGTGTATCGCCACGAGCAACCCGGCGCGGCCTTCGCGC
AGCTCGACACGATCCTGCGCGACCTGCTCGACACCGTGATCTCGACGCGCTACTTCTCCATCGTGCTGGA
AGAGCTGCGCCCCTCGTTCCACGTGGGCCGCCTCGATTCCGACAAGCTCGACGAGACCACCGCGCTGTAC
CTGTCGGTGTCCGCGGCGACGCCAGCCAGCGAGCTGGCCGAAACGGTGCCGCTGCGCTTCAAGGTCGGCG
CGCCGGACGATGTTGAGAAGCTGGTGCTGTCGGCCATGCCGGGCGTGCAACTGGCCTACACGCCACAGGT
GCCACCGGCCGTGCCGGTCAAGCCGGGCGCCTGCTATTTCACCTTGCAGACGCGCGGCTCGCTGTACGAC
CGCATGCTGCAGGCGCGCAGCATTGCCATCTACGCGCCGTCCGGCATACCCGAGCTGAAACTGGACCTGA
TCGCCGTCACCCGCTGA