SecReT6
Protein ID: 528986888
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051401
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5489329..5490108 [+]
ProductProbable transmembrane protein
NoteTssL
UniProt IDR4Y274
KEGG IDaxo:NH44784_051401
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.50E-58, Aligned region: 29..230
Protein Sequence: 259 a.a.     [Download]
>gi|528986888|ref|YP_008032205.1| Probable transmembrane protein [Achromobacter xylosoxidans NH44784-1996]
MNTAAPSLMPAASPPPRAADFYGSRPAKSLLDLLYDGFLMLFLLKSGQEPASAASFSARVQQFLADFERS
AKKLDIPAEDVYATKYAFCAAVDETVLNSGFSIRDAWMLQPLQLTLFGEQLAGENFFSRLEDLRAQGAPR
LQSLEVFYMCLLLGFQGKYMIEGQEKLGYLTARLGDEIALLRGKRAGFAPHWPLPDKIAHTLKRDVPLWS
IGALFALLGLLAYLGMAHFLNGDMQTAMAPYHDIVKLGPRAAHLTISLP
 
Nucleotide Sequence: 780 bp     [Download]
>gi|528981796|ref|NC_021285.1|:5489329-5490108 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGAACACCGCCGCGCCCTCTCTGATGCCCGCCGCCTCGCCCCCGCCGCGCGCCGCCGATTTCTACGGAT
CGCGCCCCGCCAAGTCACTGCTGGACCTGCTGTACGACGGCTTCCTGATGCTGTTCCTGCTCAAGAGCGG
GCAGGAACCGGCCAGCGCCGCGTCGTTCTCGGCGCGGGTGCAGCAGTTCCTGGCGGACTTCGAGCGCAGC
GCCAAGAAGCTCGACATACCGGCCGAGGACGTCTACGCCACCAAGTATGCGTTCTGCGCGGCGGTCGACG
AAACCGTGCTGAATTCGGGCTTCTCGATCCGCGACGCCTGGATGCTGCAACCGCTGCAACTGACGCTGTT
CGGCGAGCAGCTGGCCGGCGAGAACTTTTTCTCGCGCCTGGAGGACCTGCGCGCCCAGGGCGCGCCGCGG
CTGCAATCGCTGGAGGTGTTCTACATGTGCCTGCTGCTGGGCTTCCAGGGCAAGTACATGATCGAGGGCC
AGGAAAAGCTGGGCTACCTGACCGCGCGCCTGGGCGACGAGATCGCGCTGCTGCGCGGCAAGCGCGCCGG
CTTCGCGCCGCACTGGCCGCTGCCGGACAAGATCGCCCACACGCTCAAGCGCGACGTGCCGCTGTGGAGC
ATCGGCGCGCTGTTCGCATTGCTGGGCCTGCTGGCCTACCTGGGCATGGCGCATTTCCTGAACGGCGACA
TGCAGACGGCCATGGCGCCGTATCACGACATCGTCAAGCTCGGCCCGCGCGCCGCCCACCTGACCATCTC
GCTGCCCTGA