SecReT6
Protein ID: 528986889
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051411
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5490134..5493289 [+]
ProductVgrG protein
NoteTssI
UniProt IDR4XWX9
KEGG IDaxo:NH44784_051411
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-65, Aligned region: 44..364
Phage_GPD [PF05954], Evalue: 7.20E-65, Aligned region: 730..798
DUF2345 [PF10106], Evalue: 3.20E-43, Aligned region: 414..432
DUF2345 [PF10106], Evalue: 3.20E-43, Aligned region: 692..846
T6SS_Vgr [PF13296], Evalue: 1.40E-31, Aligned region: 538..648
T6SS_Vgr [PF13296], Evalue: 1.40E-31, Aligned region: 717..745
T6SS_Vgr [PF13296], Evalue: 1.40E-31, Aligned region: 924..953
Phage_base_V [PF04717], Evalue: 5.90E-18, Aligned region: 415..520
Sarcoglycan_1 [PF04790], Evalue: 0.00037, Aligned region: 770..827
Protein Sequence: 1051 a.a.     [Download]
>gi|528986889|ref|YP_008032206.1| VgrG protein [Achromobacter xylosoxidans NH44784-1996]
MIDRSSPPAGYSSLDVAALSQNARLLQVETPLGEALVVERLRLREGVSELFALTLDCLSASAELDVEPLL
GKEISVSLLLADGGRRRWHAVVEGVDALGADGGLARYRLHAAPWLATLRLRRDSFVFQDKSVTDILTDVF
ADYPLAAFAFDIAEPLAPRPVRTQYRETDLDFVLRLMAEAGLSFRFDHQQGDSKADGGGARHRLVVFDAR
AAQPANPAASLRFHRSDATESEDSVTRFGAAREVRANAVTRVAWNDRTLLAHGAHAESALDAGALPPLED
YDYDGHGRHPDDAAAEQLANRGLQAHEARALRFEGGGSARQMMPGHVFALTQHDRYAQGAGAAGDELGGN
RYTLLWVEHEAANNLGSQAAQALAASDLEHGAYRNDFTAQPAAAALLPAWRARPTAPEGVTALVVTAQDA
SITTGRDLRVKVQFPWQRGERPLPGGLRHRSHGDDAGNAPGDDRSGTWLRVAGAQAGPNWGAHHLPRQGT
EVVVEFLDGDIDQPVVVAQLYNDSDLPPWSAGVDGQANHPGTLSGWHSQGLDGQGHSQWLFDDTAGQVRT
RLSSSIAASQLGLGYLVKQSADDASRGEWRGSGFELRSDAWTVVRSGQGMLLSANAREGARSTQADAQEA
LALLRGARNAASRINDAATQRQARPLAANEQYDALIKAVDPKADGRYPGSVGGQQAVKAAGGERGGSDPV
ERIDGARMLIDAPSSMNLATPASAVLHASENLHVTAQADGHIAARQTFASASGRSTSLFVQDGGLRAIAA
NAPVSLQAHTDMLEMLAGQDITITSTTDSIEILANQRITLQAAGGAIVMDGGDIVFKGPGMFSVKGASHN
LIGPASDAAALPALPSSQVGDPMLVTAELVHRPNALLRALNGSGQALNAAGAADAAAAGAALPAAGTATG
GGSLLGGLGATLASGATAVSSGLQSATQTASGMVDKAKSMANAALKPVQDLGAMAGKAMGSVTEAGSGLV
SGAAAKAGGMAQSALGSATPSLMGGATPSLMGGALASAAPMPAGLADAAGAVSQAARWRTRPPRWPRKPP
H
 
Nucleotide Sequence: 3156 bp     [Download]
>gi|528981796|ref|NC_021285.1|:5490134-5493289 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGATCGATCGTTCCTCCCCGCCCGCGGGCTACAGCAGTCTGGATGTCGCCGCGCTGTCCCAGAACGCCC
GCCTGCTGCAAGTCGAAACGCCTTTGGGCGAAGCGCTCGTCGTCGAACGCCTGCGCCTGCGCGAAGGCGT
TTCGGAACTGTTCGCGCTGACCCTGGACTGCCTGTCCGCGTCGGCCGAGCTGGACGTCGAACCGCTGCTG
GGCAAGGAGATCAGCGTCAGTCTGCTGCTGGCCGACGGCGGACGGCGGCGCTGGCATGCGGTGGTGGAAG
GCGTGGACGCGCTCGGCGCCGACGGCGGGCTGGCGCGTTACCGCCTGCACGCCGCGCCCTGGCTGGCCAC
GCTGCGGCTGCGGCGCGACAGCTTCGTGTTCCAGGACAAGTCGGTCACCGATATCCTGACCGACGTGTTC
GCGGACTACCCGCTGGCCGCGTTCGCCTTCGACATCGCCGAACCGCTGGCGCCGCGCCCGGTGCGCACCC
AGTACCGGGAAACCGACCTGGACTTCGTGCTGCGGCTGATGGCCGAGGCCGGGCTGAGCTTCCGCTTCGA
CCACCAGCAGGGTGACAGCAAGGCCGACGGCGGCGGCGCGCGCCACCGCCTGGTGGTGTTCGATGCCCGC
GCCGCGCAGCCGGCCAACCCCGCCGCCTCGCTGCGTTTTCATCGCAGCGATGCCACCGAATCCGAAGACA
GCGTCACGCGCTTCGGCGCGGCGCGCGAGGTCCGCGCCAACGCCGTCACCCGCGTCGCCTGGAACGACCG
GACGCTGCTGGCGCACGGCGCCCATGCCGAATCGGCGCTGGACGCCGGCGCGCTGCCGCCGCTGGAAGAC
TACGACTACGACGGACACGGCCGCCACCCGGACGACGCCGCGGCCGAACAGCTCGCCAACCGCGGGCTGC
AGGCGCACGAGGCGCGCGCGCTGCGCTTCGAGGGCGGCGGCAGCGCCCGCCAGATGATGCCGGGCCACGT
CTTCGCGCTGACCCAGCACGACCGCTACGCGCAAGGTGCGGGCGCGGCGGGCGACGAGCTGGGCGGCAAC
CGCTACACGCTGCTGTGGGTCGAACACGAGGCCGCCAACAACCTGGGCAGCCAGGCCGCCCAGGCGCTGG
CCGCCTCCGACCTGGAGCATGGCGCCTACCGCAACGACTTCACTGCCCAGCCAGCGGCGGCGGCGCTGCT
GCCCGCCTGGCGAGCCCGGCCGACGGCGCCCGAGGGCGTGACCGCCCTGGTGGTGACGGCGCAGGATGCC
AGCATCACGACCGGGCGCGACCTGCGCGTCAAGGTGCAATTCCCGTGGCAGCGCGGCGAGCGGCCGCTGC
CGGGCGGCCTGCGCCACCGCAGCCACGGCGACGACGCCGGCAACGCGCCGGGCGACGATCGCTCCGGCAC
CTGGCTGCGCGTGGCCGGCGCCCAGGCCGGCCCCAACTGGGGCGCGCATCACCTGCCGCGCCAGGGCACC
GAAGTCGTGGTGGAATTCCTGGATGGCGACATCGACCAGCCCGTGGTGGTGGCGCAGCTCTACAACGACA
GCGACCTGCCGCCATGGAGCGCGGGCGTGGATGGCCAGGCCAATCATCCCGGCACGCTCAGCGGCTGGCA
TAGCCAGGGCCTGGACGGCCAGGGCCACAGCCAGTGGCTGTTCGACGACACCGCCGGCCAGGTGCGCACG
CGCCTGTCGAGCTCCATCGCCGCCTCGCAGCTGGGATTGGGCTATCTGGTCAAGCAGTCCGCCGATGACG
CATCGCGCGGCGAATGGCGCGGCAGCGGTTTCGAGCTGCGCTCGGACGCCTGGACCGTCGTGCGCTCGGG
CCAGGGCATGCTGCTGTCGGCCAACGCCCGCGAGGGCGCGCGCTCGACCCAGGCCGATGCACAGGAGGCC
CTGGCGCTGCTGCGGGGCGCGCGCAACGCGGCGAGCCGCATCAACGACGCCGCCACCCAGCGCCAGGCGC
GGCCGCTGGCGGCCAACGAGCAATACGATGCCCTGATCAAGGCGGTCGATCCCAAGGCCGACGGCCGCTA
TCCCGGCAGCGTCGGCGGCCAGCAGGCGGTCAAGGCCGCCGGCGGCGAACGCGGCGGCAGCGATCCGGTC
GAGCGCATCGACGGGGCCCGCATGCTGATAGACGCGCCTTCGTCGATGAACCTGGCGACACCGGCCTCGG
CCGTGCTGCACGCCAGCGAAAACCTGCACGTCACCGCCCAGGCCGACGGCCACATCGCCGCGCGCCAGAC
CTTCGCCAGCGCTTCCGGCCGCTCGACCAGCCTGTTCGTGCAGGATGGCGGCCTGCGCGCCATCGCCGCC
AACGCGCCGGTGTCGCTGCAGGCCCATACCGACATGCTCGAAATGCTGGCCGGGCAGGACATCACCATCA
CCTCCACCACCGACAGCATCGAGATCCTGGCCAACCAGCGCATCACCCTGCAGGCGGCCGGCGGCGCCAT
CGTGATGGACGGCGGCGACATTGTCTTCAAGGGGCCGGGCATGTTCTCGGTCAAAGGCGCCTCGCACAAC
CTGATCGGCCCGGCCAGCGACGCGGCCGCCCTGCCGGCCCTGCCCTCGAGCCAGGTGGGCGATCCGATGC
TGGTGACGGCGGAACTGGTGCACCGGCCGAACGCGCTGCTGCGAGCCCTGAATGGCTCCGGCCAGGCGCT
CAACGCCGCGGGCGCGGCCGATGCCGCGGCAGCGGGCGCCGCGCTGCCGGCGGCGGGCACCGCGACGGGC
GGCGGCTCCCTGCTGGGCGGCCTGGGCGCCACCCTGGCCAGCGGCGCAACGGCCGTCTCCAGCGGATTGC
AGAGCGCGACGCAGACCGCGTCCGGCATGGTGGACAAGGCCAAATCCATGGCCAACGCCGCGCTCAAGCC
GGTCCAGGACCTGGGCGCGATGGCGGGCAAGGCCATGGGCTCGGTGACCGAGGCCGGCTCGGGCCTGGTG
TCCGGCGCCGCCGCCAAGGCCGGCGGCATGGCGCAATCGGCGCTGGGTTCGGCAACGCCCTCGTTGATGG
GCGGCGCCACGCCTTCGTTGATGGGCGGCGCGCTTGCCAGCGCGGCGCCGATGCCCGCCGGCTTGGCCGA
TGCGGCCGGCGCGGTATCGCAGGCCGCGCGATGGCGGACCAGGCCACCGCGATGGCCTCGCAAGCCGCCG
CATTGA