SecReT6
Protein ID: 528986896
SecReT6 ID807
T6SS typei4b
Gene symbol-
Locus tagNH44784_051481
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5500801..5503677 [-]
ProductVgrG protein
NoteTssI
UniProt IDR4XWS5
KEGG IDaxo:NH44784_051481
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-50, Aligned region: 36..356
Phage_GPD [PF05954], Evalue: 1.80E-50, Aligned region: 451..500
Phage_GPD [PF05954], Evalue: 1.80E-50, Aligned region: 877..914
DUF2345 [PF10106], Evalue: 5.50E-38, Aligned region: 174..206
DUF2345 [PF10106], Evalue: 5.50E-38, Aligned region: 692..705
DUF2345 [PF10106], Evalue: 5.50E-38, Aligned region: 770..928
T6SS_Vgr [PF13296], Evalue: 1.20E-31, Aligned region: 603..708
Phage_base_V [PF04717], Evalue: 9.30E-18, Aligned region: 444..542
Phage_base_V [PF04717], Evalue: 9.30E-18, Aligned region: 779..794
Phage_base_V [PF04717], Evalue: 9.30E-18, Aligned region: 879..893
Protein Sequence: 958 a.a.     [Download]
>gi|528986896|ref|YP_008032213.1| VgrG protein [Achromobacter xylosoxidans NH44784-1996]
MDPTANTGLFNSDARLYGLQGEGALASLQVEGWVAREALSGVGQWRVVALSDNAGLSLQDMISRPVTLWT
TRADGSRAGRSGVVREAELLSGDAGLVRYRLTVVPWLWLATQRRASRVFEAKPVLDIVRHVLDGYEGYVY
RVAGDVEAALADLAPRPYTTQYRETDYGFIARLLAEAGLGWTVLEDAGVPARHVVQLFADSRGLAEDAES
AGGGIRFQRAAATESRDTVQMLARQRRRVPDSITVLGWHDSGKRAVAAQALVNPASGQDDAAGLDWYEVV
GHGGFADEAQARRQANLATEALRARAETFVGLGVVRTFRSGTRFTLRDLSPLGPAGEGGFEPEFALDRVE
HVGINNLPPETRASLAQRLGGLDAHLVLDGDALAAPGAEPHEAVSLRVDPAVLAKAREVGYANRFEAVRC
DRPWRPPLPSARGARLAGAPSVHGVHTAVVTDAEGGTQPKEQDEILRNKRGDVRIRFHWQGSGADGEARS
RWVRVAQRQSGAGMGISFVPRIGQEVLVRFLDDDIDQPIVVGALYNGRGEGGTPATPGGRQGAKADTQVY
AAARDNAPSAQANLASGNAPAWHGAAGGDDNHRNAAALSGFKSKEFGGSGYNQIVFDDTDGQLRMQIKSS
EQASELNLGHLIHQAGNYRGGLRGLGAELRTDGYGAVRGGAGVLLSTYSATGANASAIGDAAGVQALAGQ
TDQMARSLDGVVGAHQGLRLATVQGTRGPGASVLDGDKAPLAAMHRAVSGTVAGESLGGARGDASAKHTA
AAQGKVPHATDPVVLMAARAGLAQVAGQHLQYTAGEAVHWSAGKDQNLAVMGALRLHTGQGLGIVAGLQQ
GGAESGLDLISAKGNVDIQAQHDILRVQAQQDLKIGSAQSAVEYAAPKRIRIATAAGASIVLEGGNITVT
APGRIDVKTGNKQFAGPDRLPYAFPQFTVCKQCVLDAQDGVQSITDKA
 
Nucleotide Sequence: 2877 bp     [Download]
>gi|528981796|ref|NC_021285.1|:c5503677-5500801 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGGATCCGACCGCGAACACCGGCCTGTTCAATTCCGATGCCCGCCTTTACGGCCTGCAGGGCGAGGGCG
CGCTCGCGTCGTTGCAGGTGGAAGGCTGGGTCGCGCGCGAAGCGCTCTCGGGCGTGGGGCAATGGCGCGT
GGTGGCGCTGTCCGACAACGCCGGCCTGTCCTTGCAGGACATGATCTCGCGGCCCGTCACGCTGTGGACC
ACCCGCGCCGACGGCAGCCGCGCCGGGCGCAGCGGCGTCGTCCGCGAAGCGGAATTGCTGTCCGGCGACG
CCGGCCTGGTGCGCTACCGGCTGACGGTGGTGCCATGGCTGTGGCTGGCCACGCAGCGGCGCGCCAGCCG
CGTGTTCGAGGCCAAGCCCGTGCTGGACATCGTGCGCCACGTGCTGGACGGCTACGAAGGGTATGTCTAC
CGCGTCGCCGGCGACGTGGAGGCGGCGCTGGCCGACCTGGCGCCGCGTCCCTACACCACGCAGTACCGCG
AGACCGACTACGGCTTCATCGCCCGCCTGCTGGCCGAGGCCGGCCTGGGCTGGACCGTGCTGGAAGACGC
CGGCGTGCCAGCGCGCCACGTGGTGCAGTTGTTCGCCGACAGCCGCGGCCTGGCCGAAGACGCCGAGTCC
GCCGGCGGCGGCATCCGCTTCCAGCGGGCCGCCGCGACCGAGTCGCGCGACACCGTGCAGATGCTGGCGC
GCCAGCGCCGCCGCGTGCCCGACAGCATCACCGTGCTGGGCTGGCACGACAGCGGCAAGCGCGCGGTGGC
GGCGCAGGCGCTGGTCAACCCGGCCAGCGGCCAGGACGACGCCGCCGGGCTGGATTGGTACGAGGTCGTC
GGCCACGGCGGTTTCGCCGATGAAGCGCAGGCGCGGCGCCAGGCCAATCTGGCGACCGAAGCCCTGCGCG
CCCGCGCCGAGACCTTCGTCGGCCTGGGGGTGGTGCGCACCTTCCGTTCCGGCACGCGTTTTACGTTGCG
GGATCTGTCGCCGCTGGGGCCGGCCGGGGAAGGCGGCTTCGAACCGGAGTTCGCGCTCGATCGCGTCGAA
CACGTGGGCATCAACAACCTGCCGCCCGAGACGCGGGCTTCGCTGGCCCAGCGCCTGGGAGGGCTGGATG
CGCACTTGGTGCTGGACGGCGACGCGCTGGCCGCGCCGGGCGCCGAACCGCATGAAGCCGTGTCGCTGCG
CGTGGACCCGGCGGTGCTGGCCAAGGCGCGCGAGGTCGGCTATGCCAACCGCTTCGAGGCCGTGCGCTGC
GACCGCCCCTGGCGACCGCCGTTGCCAAGCGCCCGCGGCGCGCGGCTGGCGGGCGCGCCTTCGGTGCACG
GCGTGCATACCGCCGTCGTGACGGATGCCGAAGGCGGCACCCAGCCGAAGGAGCAGGACGAGATCCTGCG
CAACAAGCGCGGCGACGTGCGCATCCGCTTCCATTGGCAGGGGAGCGGCGCCGATGGCGAAGCCCGCAGC
CGCTGGGTACGGGTGGCGCAGCGCCAGTCGGGCGCCGGCATGGGCATCAGTTTCGTGCCGCGCATCGGCC
AGGAGGTGCTGGTGCGCTTCCTGGATGATGACATCGACCAGCCCATCGTCGTGGGCGCGTTGTACAACGG
CCGCGGCGAAGGCGGCACGCCGGCCACGCCTGGCGGCCGTCAGGGCGCCAAGGCTGACACGCAGGTCTAC
GCCGCGGCCCGCGATAACGCGCCCAGCGCCCAGGCCAACCTGGCGTCCGGCAATGCCCCGGCCTGGCATG
GCGCGGCCGGCGGCGACGATAACCACCGCAACGCGGCCGCGTTGAGCGGCTTCAAGAGCAAGGAATTCGG
CGGCTCCGGCTACAACCAGATCGTGTTCGACGATACTGACGGCCAGCTGCGCATGCAGATCAAGAGCAGC
GAGCAGGCCAGCGAACTGAACCTGGGCCACCTGATCCACCAGGCCGGCAACTATCGCGGCGGCCTGCGCG
GCCTGGGCGCGGAATTGCGCACCGACGGCTATGGCGCGGTGCGCGGCGGCGCTGGCGTGCTGCTGAGCAC
CTATAGCGCCACCGGCGCCAACGCCAGCGCCATCGGCGACGCCGCCGGGGTGCAGGCGCTGGCCGGCCAG
ACCGACCAGATGGCGCGTTCGCTCGATGGCGTGGTGGGCGCGCACCAGGGCCTGCGGCTGGCGACGGTGC
AGGGCACGCGCGGCCCCGGCGCCAGCGTGCTCGATGGCGACAAGGCGCCGTTGGCGGCGATGCACCGCGC
GGTCTCCGGCACCGTGGCGGGCGAGAGCCTGGGCGGGGCGCGCGGCGACGCGTCGGCCAAGCACACCGCC
GCGGCGCAGGGCAAGGTGCCGCATGCCACCGACCCGGTGGTGCTGATGGCGGCGCGCGCCGGCCTGGCGC
AGGTCGCCGGCCAGCATTTGCAGTACACCGCCGGCGAGGCGGTGCACTGGTCCGCGGGCAAGGACCAGAA
CCTGGCGGTGATGGGGGCGCTGCGCCTGCATACCGGCCAGGGCCTGGGCATCGTGGCCGGCCTGCAGCAG
GGCGGCGCGGAATCGGGCCTGGACCTGATCTCGGCCAAGGGCAACGTCGACATCCAGGCGCAGCACGACA
TCCTGCGCGTGCAGGCGCAGCAGGACCTGAAGATCGGCAGCGCCCAGAGCGCGGTGGAGTACGCCGCGCC
CAAGCGCATCCGCATTGCCACGGCGGCGGGCGCCAGCATCGTGCTCGAAGGCGGCAACATCACCGTCACC
GCGCCGGGCCGCATCGACGTCAAGACCGGCAACAAGCAGTTCGCCGGACCGGACCGGCTGCCTTACGCCT
TCCCGCAATTCACCGTCTGCAAGCAGTGCGTGCTGGACGCGCAGGATGGCGTGCAGTCCATCACCGACAA
GGCGTGA