SecReT6
Protein ID: 529220040
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08680
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1865306..1867879 [+]
Productprotein disaggregation chaperone
NoteTssH
UniProt IDS5UZY2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.40E-39, Aligned region: 262..262
AAA_2 [PF07724], Evalue: 8.40E-39, Aligned region: 600..761
AAA [PF00004], Evalue: 2.50E-17, Aligned region: 30..57
AAA [PF00004], Evalue: 2.50E-17, Aligned region: 223..327
AAA [PF00004], Evalue: 2.50E-17, Aligned region: 606..724
AAA_5 [PF07728], Evalue: 4.20E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 4.20E-14, Aligned region: 605..726
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 24..75
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 437..456
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 580..646
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 671..699
ClpB_D2-small [PF10431], Evalue: 8.30E-10, Aligned region: 756..819
AAA_22 [PF13401], Evalue: 8.50E-09, Aligned region: 25..66
AAA_22 [PF13401], Evalue: 8.50E-09, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 8.50E-09, Aligned region: 604..639
AAA_25 [PF13481], Evalue: 2.50E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 2.50E-05, Aligned region: 282..307
AAA_25 [PF13481], Evalue: 2.50E-05, Aligned region: 600..634
AAA_25 [PF13481], Evalue: 2.50E-05, Aligned region: 667..688
AAA_14 [PF13173], Evalue: 3.70E-05, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 3.70E-05, Aligned region: 605..695
NACHT [PF05729], Evalue: 9.20E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 9.20E-05, Aligned region: 403..420
NACHT [PF05729], Evalue: 9.20E-05, Aligned region: 606..634
AAA_29 [PF13555], Evalue: 0.00019, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 0.00019, Aligned region: 603..630
DUF258 [PF03193], Evalue: 0.00025, Aligned region: 191..239
DUF258 [PF03193], Evalue: 0.00025, Aligned region: 606..624
AAA_19 [PF13245], Evalue: 0.00027, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00027, Aligned region: 597..627
Clp_N [PF02861], Evalue: 0.00097, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.00097, Aligned region: 117..123
AAA_18 [PF13238], Evalue: 0.0035, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0035, Aligned region: 606..642
Zeta_toxin [PF06414], Evalue: 0.0052, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0052, Aligned region: 604..645
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 275..308
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 606..626
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 676..687
AAA_17 [PF13207], Evalue: 0.0062, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0062, Aligned region: 606..640
Protein Sequence: 857 a.a.     [Download]
>gi|529220040|ref|YP_008381206.1| protein disaggregation chaperone [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MIQIDLATLVKRLAPFAKQALEAAASECMSQQAAEITVAHVLLQMLATPRSDFRVIAERAEIGADDLRQA
LTVENYATARSSDSYPSFSPMLVEWLKEAWLLASAEMQQTELRGGVLLLALLHSPLRYLPPAAARLLTAI
NRDLLRQDFAGWTKESAESVILNADGQTASAIADTGDTLLARYAKNMTDDARQGRLDPVLCRDNEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIIAGQVPDKLRDTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVIQSPKPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDSGLSA
VYEQSHGVLIDDEALQAAATLSERYLSGRQLPDKAIDVLDTACAPSPPRQISALTTLRQQCEAEIRQLER
EIRIGLRSDTSRLNEVLAQYDETLSELDALEAAWRQQQTLVQEIIALRKGLLDETDATGNDETATPETEA
VGSDDESVTAPPEAEPEISPAARLAQLTAELDALHHTQLLVSPHVDKKQIASVIAEWTGVPLNRLSQNEM
SVITDLPQWLGDTIKGQALAIKHLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGR
QYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDK
GEMADGEGRLIDCKNVVFFLTSNLGYQVIVEHADNPEAMQEALYPVLADFFKPALLARLDNVLRARFGAE
VVIEPEVTDEIMQRVTRAENGARMLESVIDGEMLPPLSLLLLQKMAANIAIARITLGVANGAFTADVEDV
PDEDTQPVAEAEDEAVL
 
Nucleotide Sequence: 2574 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1865306-1867879 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGATCCAGATTGACTTAGCCACCCTGGTAAAACGGCTTGCTCCCTTCGCGAAACAGGCGCTGGAAGCGG
CGGCGTCGGAGTGTATGAGCCAGCAGGCGGCAGAAATTACCGTCGCGCATGTGCTGCTACAGATGCTGGC
GACCCCGCGCAGCGACTTTCGGGTGATTGCCGAACGTGCGGAGATCGGCGCCGATGATTTACGCCAGGCG
CTGACGGTGGAAAATTACGCCACCGCCCGTTCATCCGACAGCTACCCGTCGTTTTCCCCGATGCTGGTTG
AATGGCTGAAAGAGGCCTGGCTGCTGGCCTCCGCGGAAATGCAGCAGACCGAACTGCGCGGCGGCGTGCT
GCTGCTCGCCCTGCTGCATTCGCCGTTGCGCTACCTGCCGCCCGCCGCCGCCCGGTTGCTGACCGCCATC
AACCGCGACCTGCTCCGGCAGGATTTTGCCGGGTGGACGAAGGAGTCCGCCGAATCGGTGATCCTGAATG
CGGACGGACAGACCGCCAGCGCCATAGCCGATACCGGCGACACCCTGCTGGCCCGCTATGCCAAAAACAT
GACCGACGATGCCCGGCAGGGGCGGCTTGATCCGGTGCTGTGCCGCGATAACGAAATTGACCTGATGATC
GATATCCTCTGCCGCCGCCGTAAAAATAATCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATTATTGCCGGTCAGGTGCCGGACAAACTGCGCGATACCGATATTAT
GACGCTGGATCTCGGCGCATTACAGGCGGGCGCGTCGGTGAAAGGTGAATTTGAGAAGCGCTTTAAGGGG
CTGATGGCGGAAGTCATTCAGTCGCCGAAACCCGTCATCCTGTTTATCGACGAAGCCCACACGCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCACTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAATACAAAAAATACTTCGAGAAAGACTCCGGCCTGTCGGCG
GTGTATGAGCAGTCCCACGGCGTGCTGATTGACGATGAAGCCTTACAGGCCGCTGCGACGTTGAGCGAGC
GCTACCTGTCAGGCCGCCAGTTGCCGGATAAGGCCATTGATGTGCTGGATACCGCCTGCGCCCCCTCGCC
GCCGAGACAAATCTCGGCGCTGACCACCCTGCGCCAGCAGTGTGAAGCGGAAATCCGCCAGCTTGAGCGT
GAGATCCGTATTGGCCTGCGGTCGGACACCTCACGGCTAAACGAGGTTCTGGCGCAGTATGACGAAACGC
TGAGCGAACTGGATGCGCTGGAGGCCGCGTGGCGCCAGCAGCAGACGCTGGTGCAGGAGATTATCGCGCT
GCGTAAGGGGCTGCTGGACGAAACGGACGCTACCGGCAACGACGAAACCGCAACGCCTGAAACAGAGGCG
GTGGGCAGTGACGATGAATCCGTCACAGCGCCGCCGGAAGCGGAACCGGAAATTTCGCCAGCCGCCCGCC
TCGCGCAGCTCACCGCCGAACTGGACGCCCTGCACCACACGCAGCTGCTGGTCTCCCCACACGTCGATAA
AAAACAGATAGCCAGCGTGATTGCCGAATGGACCGGCGTGCCGCTTAACCGCCTGTCACAAAACGAAATG
TCGGTCATCACCGACCTGCCGCAGTGGCTGGGCGACACCATTAAAGGCCAGGCGCTGGCGATTAAGCACC
TGCACAAACACCTGCTGACCGCCCGCGCCGATCTGCGCCGTCCGGGACGCCCGCTCGGCGCGTTCCTGCT
GGCCGGTCCCAGCGGTGTCGGCAAAACCGAAACCGTGCTGCAACTGGCCGAACTGCTCTACGGCGGTCGC
CAGTACCTGACCACCATCAATATGTCGGAGTTTCAGGAGAAACACACCGTTTCACGCCTGATTGGTTCGC
CGCCGGGCTATGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAAGCGATTCGTCAGAAACCGTACTCCGT
GGTGCTGCTCGACGAGGTGGAGAAAGCCCACCCGGACGTGCTCAACCTGTTCTACCAGGCGTTCGACAAG
GGCGAGATGGCCGATGGCGAAGGGCGTCTTATCGACTGTAAAAATGTGGTGTTCTTCCTCACCTCCAACC
TCGGCTATCAGGTGATTGTCGAACATGCCGACAACCCGGAAGCCATGCAGGAAGCGCTGTACCCGGTACT
GGCGGACTTCTTTAAACCGGCGCTGCTGGCGCGGCTGGACAACGTACTGCGCGCCCGCTTCGGCGCGGAG
GTGGTGATTGAGCCGGAGGTGACCGACGAAATCATGCAGCGCGTCACCCGCGCCGAAAACGGCGCGCGGA
TGCTGGAGTCGGTCATCGACGGCGAGATGCTGCCGCCGCTCTCCCTGCTGCTGTTGCAGAAAATGGCGGC
GAATATCGCCATTGCCCGTATCACGCTGGGCGTGGCAAACGGCGCGTTTACCGCGGATGTGGAGGATGTG
CCGGATGAGGATACTCAGCCCGTAGCGGAAGCAGAGGACGAAGCCGTTCTATGA