SecReT6
Protein ID: 529222302
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08615
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1852321..1854432 [-]
Producttype IV secretion protein Rhs
NoteTssI
UniProt IDS5UR03
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-65, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 3.50E-26, Aligned region: 365..457
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 499..521
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 523..545
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 539..561
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 574..578
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 607..623
Protein Sequence: 703 a.a.     [Download]
>gi|529222302|ref|YP_008381193.1| type IV secretion protein Rhs [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MSTGLRFTLEVDGLPPDALVVESFHLSQSLSTLFSLDISLVSQQLHNIEFAQVLEKPAHLKIWQGTEIQR
RVNGIVTWFEQGENDGHQMLYSMKVRPPVWRAALRQNSRIFQNEDIKSILGTILQENGVTDWSPLFSEAH
PAREFCVQYSETDYDFLARMAAEEGIFFYEEHAQTSDDQSLVLCDTVRFLPEAFEIPWNPNTRTEVSTPC
VSQFRHSAQIRPSSVIGKDYTFKRPGWAGRFEHQGEHQDYQRTQYEVFDYPGRFKDGHGQNFARWQMEGW
RNNAEVAQGKSRSPAIWPGRRIQLTEHPQASLNREWQVVSSDLHGSQPQAAGRSGSGTTLDNHFTVIPAD
RTWRPRPLPKPSVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPANQDSSCWIRVVQAWAGPGFGN
LAIPRVGQEVIVDFLNGDPDQPIIMGHTYHQENRSPGSLPGTKTQMTIRSKTYKGSGFNELMFDDATGKE
RVYIHAQKNMNTEVLHNRTTDVTNNHAETIGNNQVIAVTNNQIQTIGVNQVEKVGSNQVIKVGANQVETV
GIVRALNVGLAYQTTVGGIMNTSVALMQSSEVGIFKSLNVGMKYNVNVGRNASVNVGNSKTESTGKTAVY
SAGEHLELVCGEARLVLTSDGGIFLNGKHIELQGVDSLNGDSKLISWNCGVSKKPPEASEQQDDPDPSDL
IMY
 
Nucleotide Sequence: 2112 bp     [Download]
>gi|529218781|ref|NC_021984.1|:c1854432-1852321 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGTCAACAGGATTACGTTTCACACTGGAGGTGGACGGCCTGCCACCGGATGCGCTGGTCGTGGAGTCCT
TTCACCTGAGCCAGTCCCTTTCCACGTTATTTTCCCTCGATATCTCGCTGGTCAGTCAGCAACTTCACAA
CATTGAGTTTGCCCAGGTACTGGAAAAACCGGCGCACCTGAAAATCTGGCAGGGCACGGAGATACAGCGC
CGGGTGAACGGCATAGTGACCTGGTTTGAGCAGGGGGAAAACGACGGACACCAGATGCTGTACAGCATGA
AAGTTCGTCCGCCGGTGTGGCGCGCCGCGCTGCGGCAGAACTCGCGTATTTTCCAGAATGAAGACATAAA
AAGCATTCTCGGGACGATACTGCAGGAAAACGGCGTGACGGACTGGAGCCCGCTGTTCAGTGAGGCGCAT
CCGGCGCGGGAGTTCTGCGTGCAGTACAGCGAAACGGATTACGACTTTCTGGCGCGGATGGCGGCGGAGG
AAGGTATTTTCTTTTACGAGGAACATGCGCAGACCAGCGACGACCAGAGCTTGGTGCTGTGCGACACGGT
ACGTTTTCTGCCGGAAGCCTTTGAAATCCCCTGGAACCCGAACACCCGTACCGAGGTGAGCACGCCGTGC
GTCAGCCAGTTCCGCCACAGCGCGCAAATCCGCCCCTCTTCCGTCATCGGCAAGGACTACACCTTCAAAC
GCCCCGGCTGGGCGGGCCGCTTTGAGCACCAGGGCGAACATCAGGATTACCAGCGCACGCAGTATGAGGT
CTTTGATTATCCGGGGCGCTTCAAGGACGGCCACGGTCAGAACTTCGCCCGCTGGCAGATGGAAGGCTGG
CGTAATAATGCCGAAGTGGCGCAGGGGAAAAGCCGTTCGCCGGCGATATGGCCGGGACGGCGTATTCAGC
TGACGGAACACCCGCAGGCGAGCCTGAACCGGGAATGGCAGGTGGTGAGCAGCGATTTACACGGCAGCCA
GCCGCAGGCGGCGGGGCGCTCAGGTTCAGGGACAACGCTGGACAATCATTTTACGGTCATCCCGGCAGAC
AGAACATGGCGGCCACGCCCGCTGCCCAAACCATCAGTGGACGGCCCGCAGTCGGCGGTGGTCACCGGCC
CGGAAGGGGAAGAAATCTTCTGCGACGAACATGGCCGTGTACGGGTGAAATTTAACTGGGACCGGTATAA
CCCGGCGAACCAGGACAGCTCGTGCTGGATACGGGTGGTACAGGCGTGGGCGGGGCCGGGGTTCGGCAAC
CTGGCGATACCGCGCGTGGGGCAGGAAGTGATAGTGGACTTCCTCAACGGCGACCCGGACCAGCCCATCA
TCATGGGGCACACCTACCACCAGGAAAACCGCTCACCGGGCAGCCTGCCGGGCACCAAAACGCAGATGAC
CATCCGCTCGAAAACCTATAAAGGCAGCGGGTTTAACGAACTCATGTTTGATGATGCGACAGGGAAGGAG
CGCGTGTATATCCACGCGCAGAAGAATATGAATACCGAGGTGCTGCACAACCGCACCACCGATGTGACGA
ATAATCATGCTGAAACCATTGGTAATAACCAGGTGATTGCCGTTACCAATAACCAAATCCAGACCATCGG
CGTCAACCAGGTGGAGAAGGTGGGCAGTAACCAGGTGATCAAGGTGGGTGCCAATCAGGTGGAAACGGTG
GGGATTGTCCGCGCCCTGAATGTGGGGCTGGCATACCAGACTACCGTGGGCGGCATCATGAATACCTCGG
TGGCGCTGATGCAGTCTTCTGAGGTCGGGATCTTCAAATCACTGAATGTGGGAATGAAATACAACGTCAA
TGTCGGGCGTAATGCCAGCGTTAACGTGGGCAACAGTAAAACCGAAAGTACCGGTAAAACGGCGGTGTAT
TCCGCAGGCGAGCATCTGGAGCTGGTGTGTGGTGAAGCCCGTCTGGTGCTGACGAGCGACGGCGGTATTT
TTCTGAACGGCAAACATATTGAGTTGCAGGGCGTGGACAGCTTAAACGGGGATTCAAAGCTGATCAGCTG
GAACTGTGGGGTGAGCAAGAAGCCACCTGAAGCATCTGAACAGCAGGATGACCCCGATCCATCGGATCTG
ATCATGTACTGA