SecReT6
Protein ID: 529222305
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08630
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1855800..1856303 [+]
Producthypothetical protein
NoteTssB
UniProt IDS5V5F9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.60E-54, Aligned region: 7..163
Protein Sequence: 167 a.a.     [Download]
>gi|529222305|ref|YP_008381196.1| hypothetical protein I137_08630 [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MSKDYNGSVAPKERINISYIPKTDGEPSEVELPLNMLIVGDTGNSQETAPLDERQMVSIDKHSFNSVMAE
ASISLNFAVPASLKDNAKDGDEMNISLEIKSLNDFSPDSVAKQVPELNKLLELREALTALKGPLGNLPAF
RAQLQALLENEESREQLLREISQAENQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1855800-1856303 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGAGCAAAGATTATAACGGCAGCGTGGCACCCAAAGAACGCATTAATATTTCTTACATTCCAAAAACGG
ACGGTGAGCCTTCTGAGGTGGAATTACCCCTTAATATGTTGATAGTGGGGGATACCGGAAACTCACAGGA
AACAGCGCCACTTGATGAACGCCAGATGGTTTCTATCGACAAACATTCATTCAATTCAGTGATGGCAGAA
GCGTCCATTAGCCTGAATTTTGCAGTTCCGGCATCATTGAAGGACAACGCAAAAGATGGCGATGAGATGA
ATATCTCGCTGGAAATCAAATCCCTGAACGATTTTTCTCCGGACAGCGTGGCAAAACAGGTACCGGAGTT
GAACAAATTGCTGGAACTACGCGAAGCGCTGACAGCATTAAAAGGCCCGCTCGGTAATCTGCCTGCATTT
CGCGCCCAGCTTCAGGCATTGCTGGAAAATGAAGAATCCCGCGAACAGTTACTGCGGGAGATCAGCCAGG
CAGAAAACCAGTAA