SecReT6
Protein ID: 529222306
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08635
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1856333..1856545 [+]
Producthypothetical protein
NoteTssC
UniProt IDS5UFD9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.002, Aligned region: 36..68
Protein Sequence: 70 a.a.     [Download]
>gi|529222306|ref|YP_008381197.1| hypothetical protein I137_08635 [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MGLREETSRTDDAITQAVIRLFISQTGDINTETLEVLVAALDQRIGCLMDEIIHINGYQQMKPHWRKVFH
 
Nucleotide Sequence: 213 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1856333-1856545 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGGGCTTGCGGGAAGAGACCTCCAGAACCGATGACGCAATAACGCAGGCAGTGATCCGGTTATTTATCA
GTCAGACAGGCGACATCAACACAGAAACACTGGAGGTATTGGTCGCGGCGCTTGACCAGAGGATCGGATG
TCTGATGGATGAAATCATCCATATCAACGGGTACCAGCAGATGAAGCCACACTGGCGAAAGGTGTTCCAC
TGA