SecReT6
Protein ID: 529222307
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08645
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1858063..1858479 [+]
Producttype VI secretion protein
NoteTssE
UniProt IDS5UR06
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-15, Aligned region: 32..115
Protein Sequence: 138 a.a.     [Download]
>gi|529222307|ref|YP_008381199.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MIPAREKPAGSLFERLENPPARNWREGSNIEAFRQSIRHSLRNILNTRSGSCRGTPGLGIEEPEGSDNYR
SAMSQAIVQCIERYEPRISHAEVRAILPQAASPQEIIFRITAWVTFNDIDDVLEFDMAPDGSQHYRVE
 
Nucleotide Sequence: 417 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1858063-1858479 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
GTGATACCGGCGCGCGAAAAGCCTGCCGGATCGCTGTTTGAGCGTCTGGAAAACCCTCCTGCCAGAAACT
GGCGGGAGGGCAGTAATATAGAGGCGTTCAGGCAGTCCATTCGCCATAGTCTGCGCAATATCCTGAACAC
CCGCTCCGGCAGTTGTCGGGGAACACCGGGGCTGGGTATTGAAGAGCCGGAAGGGTCGGATAATTACCGC
AGCGCCATGAGCCAGGCCATCGTGCAGTGTATTGAGCGTTATGAACCCCGGATTTCGCACGCGGAGGTCC
GGGCAATCCTGCCACAGGCCGCCAGCCCACAGGAGATAATTTTTCGTATCACCGCCTGGGTGACATTTAA
CGATATCGACGATGTGCTGGAGTTTGATATGGCACCGGACGGTAGTCAGCATTATCGGGTGGAGTAG