SecReT6
Protein ID: 529222308
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08650
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1858484..1860289 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDS5VAD4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-184, Aligned region: 5..600
Protein Sequence: 601 a.a.     [Download]
>gi|529222308|ref|YP_008381200.1| type VI secretion protein [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIRMLWPNYLRPVPSMTLIEYTPDMDKTSVPVLIPRNEQFTTGAKGTQGNPVLSAYSGNEHDVAPPCTFT
LCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFATLDLNRLRFWLGNDDNYTRYQLYLWFCEYLQ
GAELMAGGQSIPMPEFMLKAVGFESEDAMLPWPGNVHSGYRILQEFFCYADSFLFFDACGIPALPDRLKE
NRFTLRLRFSRPLPADIRLRDDSLRLYCAPAINLFSHHAEAITLDHQRQDYALVPSRHFPDHYDIFSVNS
VVSQTQGKQRKADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHRTRTSLFHRGFDHTLAFIHAD
GSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNITRPTRPLWPVIDGSLHWSLL
SAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETTPVDRLFTGIPVRGLASTLSI
HTEPFVCEGEMYLLGAVLSHFLSLYAIVNSFHMLTVVNTES
 
Nucleotide Sequence: 1806 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1858484-1860289 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGGAATTCGAAGAACGCTATTACAGGCAGGAGTTGGATCACCTGCGGCAGTTGAGCAAGCTGCTGGCGA
CCGAAAAGCCGCATCTGGCCCGGTTTCTGGCAGAAAAAGAGGCCGATCCGGATATCGAGCGTCTGCTGGA
GGGCGTGGCCTTTCTGACCGGCAATCTGCGCCAGAAAATCGAGGATGAGTTTCCGGAGCTGACGCACGGA
CTGATCCGGATGCTGTGGCCCAATTATCTGCGCCCGGTGCCGTCGATGACGCTGATTGAATATACGCCGG
ATATGGATAAAACTTCCGTGCCGGTACTGATCCCCCGTAATGAGCAGTTCACAACCGGGGCGAAGGGGAC
TCAGGGAAACCCGGTATTGTCTGCGTATTCCGGCAATGAGCACGATGTAGCCCCGCCCTGTACGTTCACC
CTGTGCCGGGATATCTGGCTGTTACCCGTTCAACTGGATCAGGTTGAAAATCGCAGTACGCCCCGCCACG
GCATTATTGATATTACGTTTGCCGTCGCACCGGGCACTGATTTTGCCACGCTGGATCTGAACAGGCTGCG
CTTCTGGCTGGGCAACGATGATAACTATACCCGCTATCAGCTTTATCTGTGGTTTTGTGAATATTTACAG
GGCGCAGAGTTGATGGCGGGCGGGCAGTCGATCCCGATGCCTGAATTTATGCTGAAAGCGGTGGGTTTTG
AGTCAGAGGACGCCATGCTGCCCTGGCCCGGCAATGTCCACAGCGGCTACCGCATTCTCCAGGAGTTTTT
CTGCTACGCCGACAGTTTTCTGTTTTTCGATGCCTGTGGCATTCCGGCATTGCCAGACAGGTTAAAGGAG
AACCGTTTCACTCTGCGGCTGCGGTTTTCTCGCCCCTTACCGGCAGATATCCGGCTGCGGGATGATTCCC
TGCGCTTATATTGTGCGCCCGCCATTAATCTGTTTTCCCACCATGCCGAAGCCATCACGCTGGATCATCA
GCGGCAGGATTACGCTCTGGTTCCCAGCCGTCATTTTCCGGATCATTACGACATTTTTTCGGTTAACAGC
GTGGTGAGTCAGACGCAGGGGAAGCAGAGAAAAGCGGATCTTGGACGGCCGGTGATCACAGAGGCCGCGC
GCCACTGGCCTGCTTTTGAGAGTTTCCGCCACCAGATGGAGTACAGCCGTAAGCGGGAAGTGGTCTACTG
GCAGCACCGGACCAGGACCTCGCTGTTTCACCGGGGCTTTGATCATACCCTGGCTTTTATTCATGCCGAT
GGCAGCCTCCCGGATGCCTCACTGCTTAATAATGAAGTGGTTTCTGTATCGCTGACCTGCACCAACCGGG
AGCTGCCGGTACAGCTACGGCCCGGCGATATCACCGGTACGACAGGTAAAAACGCGTCGGTGGCGTCATT
TCGCAATATCACCCGCCCCACCAGACCGCTCTGGCCGGTGATTGACGGCAGCCTGCACTGGTCGTTGCTG
TCTGCCATGAACCTGAATTATCTGTCGTTGCTGGATGCTGATGCGCTCAAACAGGTGATCGCCAATTTTG
ATCGCCACGCCATCCATCATCCGCAGATGGCCCGTCTGTCACAGCAGAAGCTGGACGCCATTGAACGGCT
GGAAACAACCCCGGTTGATCGCCTGTTTACCGGCATACCGGTGCGCGGGCTGGCGTCCACCCTGTCCATT
CATACGGAGCCGTTTGTCTGCGAGGGTGAAATGTACCTGCTGGGCGCGGTGCTGTCGCATTTTCTGTCGC
TGTACGCCATCGTCAATTCGTTCCACATGCTGACCGTCGTTAACACGGAAAGCTAG