SecReT6
Protein ID: 529222310
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08660
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1861414..1862700 [+]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDS5V5G1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 428 a.a.     [Download]
>gi|529222310|ref|YP_008381202.1| type VI secretion system protein ImpI [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MAEEKARQQTLSLHVVNGNELESGRTARCLFTGDGDVGHGSECHWPVQDRHQNVPAKAFSISLHDGAFCL
HPLASPLWLNQAKVTAASDQVQLRQGDEIQTGHLILRVYLNQGGMRHYDEEMATPETIVSNHDLLSDTLL
STDGAPEYPGMPSRHQLADTVVNGFSTDPLQVLQAESLTTRDNPLAGITPARPSAPLSDPAINGGINTPF
MDLPSMYADPHDNEEGMSPADAAQRHLAVTPLLRGLGGSLAVHNTQDADDFLEEAGRTLQAAIQGLLELQ
QRRNSLSDKHLRPLEDNPLRLNMDYATALDVLFAEGKSPVHLAAPAAVSESLRNIRHHEEANRAAIVESL
RVLLDAFSPQSLMRRFVQYRRSHELRKPLDDAGAWQMYCDYYDELASSRQQGFEMLFNEVYAQVYDRVLR
EKQREPEA
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1861414-1862700 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGGCGGAAGAAAAAGCGCGGCAACAGACGCTTTCACTGCATGTCGTTAACGGTAACGAGCTGGAGAGCG
GACGTACCGCACGGTGTCTGTTCACCGGAGACGGCGATGTGGGCCACGGCAGCGAATGCCACTGGCCTGT
TCAGGACCGGCACCAGAACGTTCCGGCGAAGGCGTTCAGCATCAGCCTGCATGATGGCGCATTCTGCCTG
CATCCGCTGGCATCGCCATTATGGCTGAACCAGGCTAAAGTCACGGCGGCCTCAGACCAGGTGCAGTTAC
GTCAGGGCGATGAGATCCAGACCGGGCATCTGATACTCCGGGTTTATCTGAACCAGGGCGGGATGCGGCA
TTACGATGAGGAGATGGCGACGCCTGAAACCATCGTTTCTAACCACGACCTCCTGTCGGACACGCTACTG
TCCACGGACGGCGCGCCGGAATATCCGGGAATGCCGTCCCGCCATCAGCTCGCGGATACCGTTGTTAATG
GCTTTTCCACCGATCCGTTGCAGGTGCTCCAGGCTGAAAGTCTGACCACCAGGGACAATCCGCTTGCGGG
TATCACCCCGGCCCGGCCCTCCGCCCCGTTATCCGATCCGGCGATAAACGGCGGGATCAACACGCCGTTT
ATGGATCTGCCGTCCATGTATGCCGATCCGCATGATAATGAAGAGGGCATGTCACCGGCAGACGCGGCGC
AGCGCCACCTCGCCGTCACGCCGTTACTGCGCGGGCTGGGGGGATCGCTTGCCGTGCATAACACCCAGGA
CGCCGATGATTTTCTGGAGGAGGCCGGAAGGACATTGCAGGCGGCGATTCAGGGGTTGCTTGAGCTACAG
CAGCGCCGCAACAGCCTGTCAGACAAGCATCTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAATATGG
ACTACGCCACGGCGCTGGACGTGCTGTTTGCCGAAGGGAAAAGCCCGGTACATCTGGCCGCGCCCGCCGC
CGTCAGCGAGAGCCTGCGCAATATTCGTCATCACGAAGAAGCCAACCGCGCCGCGATTGTGGAATCGCTG
CGCGTGCTGCTGGACGCCTTCTCGCCACAGAGTCTGATGCGCCGTTTTGTGCAGTACCGCCGCAGCCACG
AACTGCGTAAACCGCTGGATGATGCCGGTGCGTGGCAGATGTACTGCGATTATTACGATGAGCTGGCCTC
CAGCCGCCAGCAGGGTTTTGAGATGCTGTTTAACGAAGTGTATGCCCAGGTGTATGACCGGGTGTTGCGT
GAAAAGCAGCGGGAGCCGGAAGCATGA