SecReT6
Protein ID: 529222314
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08685
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1868713..1869525 [+]
Producthypothetical protein
NoteTssA
UniProt IDS5UIC0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-09, Aligned region: 13..70
ImpA-rel_N [PF06812], Evalue: 1.20E-09, Aligned region: 194..202
Protein Sequence: 270 a.a.     [Download]
>gi|529222314|ref|YP_008381207.1| hypothetical protein I137_08685 [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MLKLGSLAHSQLDIPEIQRRGLVILASESKDFRLLAHLLRTLQHAGDPLLALRLLALYVEHYWTVAAPQN
AAHKQRFATQVLKRFETGVESFAETARTAQRDSLLAELAKLAQRWQEQNIPALAQAVDDLSSQYRRAFRG
AAPVPPAAGPSTPPAPVSATPSAPVSPSAPAATTAPPVDIDSHDDKAWRDTLLKVAAILCERQPDSPQGY
RLRRHALWQAITSVPQAESDGRTPLAAVPADMTADYQARLNNADLALWQQVEKSLLLAPY
 
Nucleotide Sequence: 813 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1868713-1869525 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGCTTAAACTCGGCTCGCTGGCGCACAGTCAGCTGGATATCCCGGAAATTCAGCGCCGGGGGCTGGTGA
TTCTGGCCTCGGAAAGCAAGGATTTTCGCCTGCTGGCCCATCTGCTGCGCACCCTGCAACATGCCGGCGA
TCCGCTGCTGGCGCTGCGTCTGCTGGCGCTGTACGTGGAGCATTACTGGACGGTGGCGGCACCACAAAAT
GCGGCACATAAACAGCGTTTCGCCACCCAGGTGCTGAAACGCTTTGAAACCGGCGTGGAGAGTTTCGCAG
AGACAGCCCGTACCGCGCAGCGCGACAGCCTGCTGGCTGAACTGGCGAAACTGGCGCAGCGCTGGCAGGA
GCAGAATATCCCGGCGCTGGCACAGGCCGTCGATGACCTCTCGTCGCAGTATCGCCGGGCATTTCGCGGG
GCCGCCCCGGTGCCGCCAGCGGCTGGCCCGTCCACGCCTCCGGCTCCGGTTTCGGCCACGCCGTCCGCCC
CGGTATCCCCGTCTGCGCCTGCGGCGACGACGGCGCCACCGGTGGATATCGACAGCCATGACGACAAAGC
CTGGCGCGACACGCTGCTGAAAGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGATTCACCGCAGGGCTAC
CGCCTGCGCCGCCATGCGTTATGGCAGGCCATTACATCCGTCCCCCAGGCCGAAAGCGACGGGCGCACAC
CGCTGGCGGCGGTGCCTGCCGACATGACCGCCGATTACCAGGCGCGGCTGAACAACGCCGATCTGGCGCT
CTGGCAACAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGA