SecReT6
Protein ID: 529222315
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08690
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1869604..1870008 [+]
Producthypothetical protein
NoteTssA
UniProt IDS5V5G4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|529222315|ref|YP_008381208.1| hypothetical protein I137_08690 [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MVRFLARLPQLATLLFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVRQCFSEQGLEATLRYLET
LPEGDPRDRFHRQYLGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLLEQLENKLTAEQ
 
Nucleotide Sequence: 405 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1869604-1870008 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
GTGGTTCGCTTTCTCGCCCGCCTGCCGCAACTTGCCACCCTGCTGTTTAATGACCGCACACCGTTTATCA
GCGAACAGACAAAACAGTGGCTGGCGGCGTCTCCGGGCAGTCAGACAGCCCCGATGGTGCGGACCAGTGA
AGACACCGAGGCCGTCCGCCAGTGTTTCAGCGAGCAGGGGCTGGAGGCCACGCTGCGATACCTGGAAACC
CTGCCGGAAGGCGATCCGCGCGATCGGTTCCACCGGCAGTATCTTGGCGCGCAACTGTTAGAAGAAGCCG
GGATGGCGCAACTGGCACAGCAACAGTACCGGATGTTGTTTAAAGCAGGGCTGCGCATGACGCTGGCTGA
ATGGGAGCCGTCCCTGCTGGAACAACTGGAAAACAAACTCACGGCAGAACAGTAA