SecReT6
Protein ID: 529222317
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08700
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1874890..1875369 [+]
ProductHcp
NoteTssD
UniProt IDS5UR15
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-29, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|529222317|ref|YP_008381210.1| Hcp [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MANLIYLTLNGEKQGLISAGCCSLDSIGNKAQLLHLDHIMVYELTHGLSRDQNVNHHSVTIKKPVDKSSP
LLGKAINDNEILTCTFDFYRTNRFGINEKYYKLELKNARISDINFSIAHVVIDSEAQPQESISFIYESIN
WEHCIAGTSAFSLWDERVF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1874890-1875369 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGGCCAATTTAATTTATTTAACACTGAACGGTGAAAAGCAAGGATTGATTTCAGCAGGTTGTTGTTCCC
TTGACTCTATCGGTAATAAAGCACAGTTACTGCACCTTGATCATATTATGGTATATGAACTGACACATGG
GTTAAGTCGGGATCAAAATGTCAATCATCATTCAGTTACGATAAAAAAACCTGTCGATAAATCATCTCCT
TTACTGGGAAAAGCAATTAACGATAATGAAATATTGACCTGCACTTTTGATTTTTATCGAACAAATCGAT
TTGGTATTAATGAAAAATATTACAAACTGGAATTAAAAAACGCCCGAATTAGTGATATTAATTTCTCGAT
TGCGCATGTAGTCATTGACAGTGAAGCACAACCTCAGGAAAGTATTTCTTTTATATATGAATCCATAAAC
TGGGAACACTGTATTGCCGGGACCAGTGCATTCAGTTTATGGGATGAGAGGGTGTTTTAG