SecReT6
Protein ID: 529236503
SecReT6 ID838
T6SS typei1
Gene symboltssQ
Locus tagBB2000_0805
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]916585..917058 [-]
ProductTssQ
NoteTssD
UniProt IDS5U0U3
KEGG IDpmib:BB2000_0805
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.10E-33, Aligned region: 6..143
Protein Sequence: 157 a.a.     [Download]
>gi|529236503|ref|YP_008397362.1| TssQ [Proteus mirabilis BB2000]
MANSIYLKIIGKSQGDISKGCSTLGSIGNKYQHGHEDQIFVYSFDYDLTRAQNLNHSPVVISKPIDKSSP
LLGVAITNNELLECELEFYRTSSNGNQEKFYTIKLTKASITNISAHYPNSLTHADAQPYEDITIRYESIS
WNHICAGTSGYSISKNI
 
Nucleotide Sequence: 474 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c917058-916585 Proteus mirabilis BB2000, complete genome
ATGGCTAATTCAATATATTTAAAGATAATAGGGAAATCTCAAGGTGATATATCTAAAGGGTGCTCTACTT
TAGGATCTATAGGCAATAAATATCAGCACGGACATGAAGATCAGATATTTGTGTATTCATTTGATTATGA
TTTAACTCGAGCACAAAATTTAAATCATTCCCCTGTGGTAATTTCAAAACCTATAGATAAATCTTCACCC
TTACTTGGGGTTGCAATAACAAATAATGAATTATTAGAGTGCGAGCTAGAATTCTATAGAACAAGTTCAA
ACGGCAATCAAGAAAAGTTTTATACCATTAAGCTAACAAAAGCCAGCATTACCAATATATCAGCACATTA
CCCTAATTCACTGACGCATGCAGATGCCCAGCCTTATGAAGATATTACTATTCGATATGAAAGTATCTCT
TGGAACCATATTTGTGCAGGAACATCAGGTTATAGTATCAGCAAAAATATTTAA

Protein ID: 529236520
SecReT6 ID838
T6SS typei1
Gene symbolidrA
Locus tagBB2000_0822
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]940506..941024 [+]
ProductIdrA
NoteTssD
UniProt IDS5TYW9
KEGG IDpmib:BB2000_0822
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|529236520|ref|YP_008397379.1| IdrA [Proteus mirabilis BB2000]
MPTPCYISIEGKTQGNITAGAFTADSVGNIYVQGHEDQMLVQEFSHVVTVPTDPQSGQPSGQRAHKPFRF
TVALNKAVPLLYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQ
LIEVSLSYRKIDWEHTVAGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|529235720|ref|NC_022000.1|:940506-941024 Proteus mirabilis BB2000, complete genome
ATGCCAACTCCTTGCTATATTTCCATTGAAGGAAAAACTCAGGGCAACATCACTGCAGGCGCGTTTACTG
CAGATTCTGTCGGCAACATTTATGTACAAGGTCATGAAGACCAAATGTTGGTACAAGAATTTTCTCACGT
GGTGACGGTTCCGACTGATCCGCAATCAGGCCAACCTTCTGGCCAACGTGCGCATAAACCGTTTCGTTTT
ACCGTGGCATTAAACAAAGCCGTTCCTCTGCTGTATAACGCATTGGCTTCCGGCGAAATGCTGCCAAAAG
TTGAGTTAAAATGGTATCGCACGTCTGTTGAAGGTAAACAAGAGCACTTCTTTACCACCACACTGACTGA
CGCGACGATCGTGAACATCGATTGCCAAATGCCTCATTGTCAAGATCCGGCTAAAGCCGACTTCACGCAA
CTTATCGAAGTTTCCCTCTCTTACCGCAAAATTGACTGGGAGCACACTGTTGCTGGAACGTCTGGTGCGG
ATGACTGGCGTGCGCCTCTCGAAGCGTAA