SecReT6
Protein ID: 529236504
SecReT6 ID838
T6SS typei1
Gene symboltssP
Locus tagBB2000_0806
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]917149..918885 [-]
ProductTssP
NoteTssF
UniProt IDS5UP54
KEGG IDpmib:BB2000_0806
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.90E-58, Aligned region: 6..564
Protein Sequence: 578 a.a.     [Download]
>gi|529236504|ref|YP_008397363.1| TssP [Proteus mirabilis BB2000]
MSEIKYIKEKQYLQKLFSEYADKAPHLASVLDPQDPQTSYLLEGFAFLSARLQDKIDDAFPEITLPLLQR
LNSQAIKGLPSTTIIQIDQSEILPYPMEINEKHLVIGDNGAQFSFCHNFTIMPYSILDRKITQHPNHSCI
SLEILYRGDVELTQTNALNVFLGENKTTSDILLLAFSQYFEKIEVVHNGERYEGDPLNYAFEPKIGNDYK
IFPQKNNSFSAPQRLLEGLYLPHVHHFIELDIPQIVTQLDWKQQQRFVVNIYFSQQLPLTQEECNQSFFL
NCAPAIDSEAKHTLLIDFKKNKSSYLLPIPTHHYLADLDKIELSLEPHELARGIYCHFYPTTELTAASRL
MPQFHKAIFYSLTMEKNITGHTLYYLNFFDNKGDPMVTPPSLHFACVYIGFEQYKRNELGLLNKHSEKMP
DAVKTGNITLLSSCYPPIVNNHHFWKLLSHYSANGSMLMSLDTIKHMISDYILYRDTDRQVTRKCERLLN
GLVELKTHLYDYILKGKPYRCLSLSLFIDETQYENRGEAFVFTTHLYHFFPFCLSENMLLEMSVTLNDQK
NTTWYLSPSPLRGYKSMI
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c918885-917149 Proteus mirabilis BB2000, complete genome
ATGAGTGAAATTAAATATATTAAAGAAAAGCAGTACTTACAAAAACTGTTCAGTGAGTATGCAGATAAAG
CGCCACATTTAGCGAGCGTACTTGATCCTCAAGATCCACAAACAAGTTATCTCTTAGAAGGCTTTGCTTT
TTTATCTGCTCGTTTACAAGATAAAATTGATGATGCTTTTCCTGAGATCACATTACCCCTACTGCAACGA
CTAAATTCCCAAGCCATTAAAGGGCTACCATCAACAACAATTATCCAAATTGACCAAAGTGAAATTCTCC
CCTATCCCATGGAGATTAATGAGAAACATTTGGTGATTGGCGACAACGGGGCACAATTTAGTTTCTGCCA
TAATTTCACCATCATGCCTTATAGCATTTTGGATAGAAAAATTACTCAGCATCCAAACCACTCTTGTATC
TCTCTTGAAATATTATATCGTGGTGATGTGGAATTAACTCAAACAAATGCACTTAATGTTTTTTTAGGGG
AAAATAAAACCACCTCAGACATTTTATTACTCGCATTTAGTCAATACTTTGAAAAAATTGAGGTGGTACA
TAACGGTGAACGTTATGAAGGCGATCCTCTTAATTATGCTTTTGAACCCAAAATTGGCAATGACTATAAA
ATCTTCCCACAGAAAAATAACTCATTTTCTGCGCCACAACGTTTATTAGAAGGTCTTTATTTACCCCATG
TTCACCATTTTATTGAGTTAGATATACCACAAATAGTGACTCAATTAGATTGGAAACAACAGCAGCGGTT
TGTTGTTAATATCTATTTCAGTCAGCAACTTCCTTTAACTCAAGAAGAGTGTAATCAGAGCTTTTTTTTA
AACTGTGCTCCAGCGATTGATAGTGAAGCAAAACATACACTTTTAATTGATTTTAAAAAGAATAAATCAA
GTTATTTACTCCCTATTCCAACCCATCACTATTTGGCCGATCTTGATAAAATTGAGTTATCACTAGAGCC
TCATGAGCTAGCGCGTGGCATATACTGTCATTTTTATCCTACGACAGAATTAACCGCCGCCTCTCGTTTA
ATGCCCCAATTTCATAAAGCCATTTTCTATTCATTAACAATGGAGAAAAATATTACTGGGCATACACTTT
ATTATTTGAATTTCTTTGATAATAAAGGTGATCCTATGGTCACACCGCCTAGTTTACATTTTGCATGTGT
TTATATTGGCTTTGAACAATATAAAAGAAATGAGTTAGGTCTATTAAATAAACACAGCGAAAAAATGCCT
GATGCAGTAAAAACGGGAAATATCACATTATTATCATCTTGTTATCCACCTATTGTAAATAATCACCATT
TTTGGAAATTGTTATCTCATTACAGTGCTAATGGTTCAATGTTAATGTCATTAGATACTATTAAACATAT
GATTTCTGATTATATTCTTTACCGAGATACTGATAGGCAGGTCACTCGAAAATGTGAGCGATTATTAAAT
GGACTCGTTGAACTAAAAACACATTTATATGACTATATTTTAAAAGGTAAACCCTATCGTTGTTTATCTT
TATCGCTATTCATTGACGAAACACAATATGAAAATAGAGGTGAAGCTTTTGTCTTTACTACACATCTTTA
CCATTTTTTCCCATTCTGTTTATCTGAAAATATGTTATTGGAAATGTCAGTTACACTCAATGATCAGAAA
AACACCACTTGGTATTTATCTCCCTCACCACTAAGGGGCTATAAATCAATGATTTAA