SecReT6
Protein ID: 529236505
SecReT6 ID838
T6SS typei1
Gene symboltssO
Locus tagBB2000_0807
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]918878..920233 [-]
ProductTssO
NoteTssA
UniProt IDS5TYV4
KEGG IDpmib:BB2000_0807
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.30E-45, Aligned region: 91..125
DUF3702 [PF12486], Evalue: 3.30E-45, Aligned region: 168..182
DUF3702 [PF12486], Evalue: 3.30E-45, Aligned region: 284..431
ImpA-rel_N [PF06812], Evalue: 6.70E-21, Aligned region: 44..103
ImpA-rel_N [PF06812], Evalue: 6.70E-21, Aligned region: 118..134
Protein Sequence: 451 a.a.     [Download]
>gi|529236505|ref|YP_008397364.1| TssO [Proteus mirabilis BB2000]
MLSAMKSESLVIKIGGSPLDTPEFIALKTEFNKLSHPARPEISWTLIESLCLSLFKNHGIDLQSGAYYTI
ARLQQHGLSGFTEGCELLANVIVTYWDSLWPEKPNQRTEVLNWFNTKASALLRQQSYQAKDLRLIYRSER
ALQLIIDKLAKTTWEKLPKIENLLWFFQNLAKQIEKQEKQTQQDSAEPVSVPPLVCIQQPSKTTDKAAPT
FVIETPQPASSFTVVAKKMSATRGFIWGCVLSCILFLAVGFGVHLYLKQEMNAITSIPEGAAAKWLFKPQ
LNSYEYHLALLEKRSPLSNLRLIDTMQEKAKNAWPTDAEQIYFTRNWQNLYQTRLENMPINDSWSETATL
LQQLSNKIVQQERNRGSFTLSYLKTAIYDIQKQHNKVEPIEEKLRQLAVQIETGQPISPATFNNIDNKIN
GLLARYYDLQKQAEQQGLKPGSYSSFGLDHE
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c920233-918878 Proteus mirabilis BB2000, complete genome
ATGTTGAGTGCGATGAAATCAGAAAGTTTAGTGATTAAAATTGGGGGATCTCCACTTGATACCCCTGAAT
TTATTGCCCTGAAAACCGAATTTAATAAATTGAGCCACCCTGCTCGACCAGAAATAAGTTGGACACTTAT
TGAGTCACTTTGCTTATCCCTATTTAAAAATCATGGTATCGACCTACAAAGCGGTGCTTACTATACCATT
GCAAGATTACAACAGCATGGTTTAAGCGGTTTTACTGAAGGATGTGAGTTATTAGCAAATGTTATTGTGA
CTTATTGGGATAGCCTGTGGCCGGAAAAGCCAAACCAACGTACAGAGGTATTAAACTGGTTTAATACCAA
AGCCAGCGCTTTATTAAGACAACAATCCTATCAAGCAAAAGATCTACGATTAATCTATCGTTCAGAGCGC
GCGTTACAGTTAATAATCGATAAACTGGCTAAAACAACTTGGGAAAAACTGCCTAAAATTGAAAACTTAC
TGTGGTTTTTCCAAAACTTAGCCAAACAAATTGAAAAACAAGAAAAACAGACGCAACAAGATAGTGCCGA
ACCCGTTAGCGTACCGCCATTAGTCTGTATTCAACAACCGTCGAAAACAACGGACAAAGCAGCCCCCACT
TTTGTGATTGAAACGCCTCAACCCGCCTCTTCTTTCACTGTAGTAGCAAAAAAAATGAGTGCGACCCGAG
GTTTTATATGGGGCTGTGTGCTCAGTTGCATACTGTTTTTAGCTGTCGGATTTGGTGTACATCTCTATTT
AAAACAAGAGATGAATGCGATTACTTCAATACCTGAAGGTGCGGCTGCTAAATGGTTGTTTAAACCACAG
TTAAATAGCTACGAATATCATTTAGCATTATTAGAAAAACGTTCTCCCCTTTCTAATTTACGGCTAATTG
ATACGATGCAAGAAAAAGCCAAAAACGCTTGGCCTACAGATGCAGAGCAAATTTATTTTACACGTAATTG
GCAAAATCTTTATCAAACTCGCTTAGAGAATATGCCAATTAATGATAGCTGGTCTGAAACCGCGACATTA
TTACAACAACTTTCTAATAAAATAGTTCAGCAAGAACGAAATAGAGGCAGTTTTACACTCTCTTATCTAA
AAACGGCAATTTATGATATTCAAAAACAGCACAATAAAGTTGAGCCAATCGAAGAAAAACTGCGACAGCT
CGCTGTACAAATTGAAACAGGGCAACCTATTTCTCCTGCAACTTTTAATAATATTGATAATAAAATTAAT
GGGTTATTAGCTCGTTATTATGATTTACAAAAACAAGCTGAACAACAAGGTTTAAAACCAGGCTCATATT
CATCTTTTGGATTAGATCATGAGTGA