SecReT6
Protein ID: 529236510
SecReT6 ID838
T6SS typei1
Gene symboltssJ
Locus tagBB2000_0812
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]926735..929446 [-]
ProductTssJ
NoteTssH
UniProt IDS5TYW0
KEGG IDpmib:BB2000_0812
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.00E-38, Aligned region: 278..325
AAA_2 [PF07724], Evalue: 4.00E-38, Aligned region: 641..802
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 221..332
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 647..772
AAA_5 [PF07728], Evalue: 7.00E-13, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 7.00E-13, Aligned region: 319..319
AAA_5 [PF07728], Evalue: 7.00E-13, Aligned region: 367..388
AAA_5 [PF07728], Evalue: 7.00E-13, Aligned region: 646..766
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 40..52
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 552..576
ClpB_D2-small [PF10431], Evalue: 1.50E-11, Aligned region: 809..882
AAA_16 [PF13191], Evalue: 9.10E-09, Aligned region: 7..50
AAA_16 [PF13191], Evalue: 9.10E-09, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 9.10E-09, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 9.10E-09, Aligned region: 486..557
AAA_16 [PF13191], Evalue: 9.10E-09, Aligned region: 621..667
AAA_16 [PF13191], Evalue: 9.10E-09, Aligned region: 712..739
AAA_16 [PF13191], Evalue: 9.10E-09, Aligned region: 804..857
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 645..664
AAA_22 [PF13401], Evalue: 1.20E-07, Aligned region: 707..740
AAA_25 [PF13481], Evalue: 4.90E-06, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 4.90E-06, Aligned region: 549..572
AAA_25 [PF13481], Evalue: 4.90E-06, Aligned region: 641..675
AAA_19 [PF13245], Evalue: 9.50E-05, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 9.50E-05, Aligned region: 640..666
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 135..183
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 220..238
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 645..686
NACHT [PF05729], Evalue: 0.00025, Aligned region: 220..248
NACHT [PF05729], Evalue: 0.00025, Aligned region: 647..674
NACHT [PF05729], Evalue: 0.00025, Aligned region: 851..876
DUF258 [PF03193], Evalue: 0.0003, Aligned region: 185..237
DUF258 [PF03193], Evalue: 0.0003, Aligned region: 647..663
AAA_29 [PF13555], Evalue: 0.0004, Aligned region: 213..237
AAA_29 [PF13555], Evalue: 0.0004, Aligned region: 644..671
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 220..261
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 647..681
IstB_IS21 [PF01695], Evalue: 0.002, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.002, Aligned region: 646..658
Arch_ATPase [PF01637], Evalue: 0.0076, Aligned region: 200..234
Arch_ATPase [PF01637], Evalue: 0.0076, Aligned region: 273..310
Arch_ATPase [PF01637], Evalue: 0.0076, Aligned region: 647..667
Arch_ATPase [PF01637], Evalue: 0.0076, Aligned region: 713..728
Protein Sequence: 903 a.a.     [Download]
>gi|529236510|ref|YP_008397369.1| TssJ [Proteus mirabilis BB2000]
MIQIDLSTLVNRLHPIAKHALESAAAYCVSHQQPEITIAQFLQKLIETPLTDIRMISQKSALDINALSEL
LDIDIPPHQVITQSYPSFSPLLVEWMKDSWLLASTELNHSELRSGALFLTLLQMPLRYLAKPVADMLAQI
NRDQLKLNFDQWTEGSAESPFNEKTVSEKGNLAADSLLAKFTHNMTEQARNGELDPVLCRDNEIDLMIDI
LCRRRKNNPVVVGEPGVGKSALIEGLALRIIAGEIPDKLRGCELLTLDLGALQAGAAVKGEFEKRFKGIM
QEVTQSPHPIILFIDEAHTLIGAGNQQGGLDVSNLLKPALARGELRTIAATTWSEYKKYFEKDAALARRF
QLVQVKEPSSTEAIIIMRGLRSIYEKSHHVFIDDEALRASAELSERYISGRQLPDKAIDVLDTACARAAI
NLSSPPKALSSLKTELHQINMEMDVLQREHYLGLDDHSERLETLASQASAIEQQATDLQQAWEQQKELVS
QIITLRATLLNNATEATNDDVANDVANNEVVSDIRTYSAAEDAEDNDEKIAAQPPCSSEELKQQLQQLDK
QLAQLHDTHLLVSPHVDKKQIAAVIAEWTGVPLNRLSQDALSIVTELPTYLEESIKGQSLAIQCLHKHLL
TARADLRRPGRPLGAFLLAGPSGVGKTETVIQIAQLMFGGTQYLTTINMSEFQEKHTVSRLIGSPPGYVG
YGEGGILTEAIRKRPYSVVLLDEVEKAHPDVLNLFYQAFDKGEIADGEGRVIDCKNIAFFLTSNLGDHVI
TAYADKPDELEDALYPELTTFFKPALLARMEVIPYLPLPAEVLRQIVDGKLARLINLLKQRFNAEINVEE
SVATEILRRASRAENGARILESIIDGALLPPLSLLLLQYSARNEAISHIRLATENDEFIAEVN
 
Nucleotide Sequence: 2712 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c929446-926735 Proteus mirabilis BB2000, complete genome
ATGATCCAAATTGATCTCTCTACTCTCGTTAATCGATTACACCCAATAGCTAAGCATGCCTTAGAAAGTG
CAGCCGCTTACTGTGTAAGCCACCAGCAACCTGAAATTACGATTGCTCAGTTTCTACAAAAACTGATAGA
AACGCCATTAACTGACATTCGTATGATCAGTCAAAAAAGCGCATTAGATATTAATGCGTTATCAGAGTTA
TTAGATATCGACATTCCGCCACATCAAGTTATTACACAAAGTTATCCTAGTTTTTCACCCTTATTAGTTG
AATGGATGAAAGATAGCTGGCTATTAGCGTCAACTGAACTAAATCACAGTGAACTTCGCTCTGGTGCATT
GTTTTTAACTTTACTACAAATGCCTTTGCGTTATCTTGCGAAACCTGTTGCCGATATGCTTGCGCAGATT
AACCGCGACCAATTAAAACTCAATTTTGATCAATGGACTGAAGGCTCTGCTGAATCGCCTTTTAACGAAA
AAACAGTATCAGAAAAAGGTAACCTTGCTGCTGATTCATTGTTAGCGAAATTTACTCATAACATGACTGA
ACAAGCGCGAAATGGTGAGTTAGATCCGGTCTTATGTCGCGATAATGAAATCGACTTAATGATTGATATT
CTGTGCCGTCGCCGTAAAAACAATCCTGTAGTAGTCGGAGAGCCCGGTGTGGGTAAAAGTGCGTTAATTG
AAGGACTAGCACTACGTATTATTGCCGGAGAGATTCCTGATAAATTAAGAGGTTGTGAACTTCTTACTCT
TGATTTAGGCGCATTACAGGCAGGTGCTGCAGTCAAAGGCGAATTTGAAAAACGCTTTAAAGGCATTATG
CAAGAAGTCACTCAATCTCCTCACCCTATCATTCTATTTATTGATGAAGCACACACCCTCATTGGTGCAG
GTAACCAGCAAGGTGGCTTAGATGTTTCTAATTTATTAAAACCGGCTTTGGCGCGTGGAGAACTACGAAC
TATCGCAGCAACGACTTGGAGCGAATACAAAAAATATTTTGAAAAAGATGCCGCGTTAGCGCGCCGTTTC
CAATTAGTGCAAGTCAAAGAGCCATCATCTACAGAAGCCATTATCATTATGCGTGGCTTACGTAGTATCT
ATGAAAAATCCCACCATGTCTTTATTGATGATGAAGCACTACGAGCCAGTGCTGAATTAAGTGAACGTTA
TATCTCTGGACGTCAATTACCAGACAAAGCCATTGATGTATTAGATACAGCCTGTGCAAGAGCCGCGATT
AACCTATCTTCGCCACCAAAGGCATTATCCTCTTTGAAAACAGAACTCCATCAAATCAATATGGAAATGG
ATGTATTACAAAGAGAACACTATTTAGGTTTAGATGATCATTCTGAGCGTCTTGAAACGTTAGCCTCACA
AGCAAGTGCTATTGAGCAACAAGCAACTGATTTACAGCAAGCATGGGAGCAACAAAAAGAGCTTGTATCT
CAAATTATTACCTTACGAGCAACATTACTTAATAATGCTACCGAAGCGACTAATGACGATGTCGCAAATG
ATGTTGCAAATAATGAAGTGGTAAGTGATATAAGAACTTATAGTGCAGCAGAAGATGCTGAAGATAATGA
TGAAAAAATAGCAGCACAGCCCCCCTGCTCATCTGAAGAATTAAAGCAACAGTTACAACAATTAGATAAA
CAACTTGCTCAGTTACACGACACGCATTTACTGGTTTCGCCTCACGTCGATAAAAAACAAATTGCGGCGG
TAATTGCTGAATGGACAGGCGTACCATTAAATCGATTATCACAAGATGCATTATCAATTGTCACTGAGTT
ACCGACCTACTTGGAAGAGAGTATCAAAGGCCAATCATTAGCCATTCAATGTTTACACAAACATTTACTT
ACAGCGCGGGCTGATTTACGTCGACCGGGTCGACCGCTGGGGGCGTTCTTATTAGCAGGTCCTAGTGGCG
TGGGTAAAACAGAAACGGTTATCCAAATTGCCCAATTAATGTTCGGTGGCACACAATATCTCACGACTAT
TAATATGTCTGAGTTTCAAGAAAAACATACTGTTTCTCGCCTTATTGGTTCACCTCCCGGTTATGTGGGA
TATGGTGAAGGAGGGATCTTAACAGAAGCTATTCGTAAAAGACCTTACTCAGTTGTTTTACTCGACGAAG
TAGAGAAAGCGCATCCTGATGTGCTAAATCTATTTTATCAAGCTTTTGATAAAGGAGAGATAGCCGATGG
AGAAGGACGAGTCATTGATTGTAAAAATATCGCATTTTTCCTCACCTCTAATTTAGGTGACCATGTCATT
ACTGCTTACGCGGATAAACCGGACGAACTAGAAGATGCACTCTACCCTGAATTAACAACTTTCTTTAAAC
CGGCATTACTTGCTCGAATGGAAGTGATCCCTTATTTACCGTTGCCTGCAGAGGTTTTACGACAAATTGT
TGATGGCAAATTAGCCCGTCTTATTAACCTGTTAAAACAGCGTTTCAACGCAGAAATCAATGTAGAAGAG
AGTGTTGCTACGGAAATTTTACGCAGAGCTTCTCGTGCTGAAAATGGTGCGCGTATTTTGGAATCTATTA
TTGATGGTGCGTTATTGCCGCCTCTTTCTTTATTACTTCTACAATATAGTGCACGTAATGAAGCTATCTC
TCATATTCGCTTAGCGACTGAAAATGATGAGTTTATTGCGGAGGTTAATTAA