SecReT6
Protein ID: 529236511
SecReT6 ID838
T6SS typei1
Gene symboltssI
Locus tagBB2000_0813
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]929455..930210 [-]
ProductTssI
NoteTssL
UniProt IDS5U8F6
KEGG IDpmib:BB2000_0813
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-61, Aligned region: 30..235
Protein Sequence: 251 a.a.     [Download]
>gi|529236511|ref|YP_008397370.1| TssI [Proteus mirabilis BB2000]
MTDDILLNHDDEERITKKNYQLPLRGNNINPMIDAATPLLGMVLRMKAMSETPLSEKLYQQVVMDITSIE
QQLQIQGYEPGAIVSFRYVLCTFIDETALGLGWDQDNGWVKQSLLVHFHNESWGGEKVFVLIERLLGEPK
RYLDLIEFIYLCLCLGYRGRYKVSAGQNDEFNHLLRRLQKQIQQLRGNAKPIVLFEKGDNQQSRYRLGKR
LGARYILIGTAVFALIIYSIYSSRLNYQTLSIVEQLNTLLG
 
Nucleotide Sequence: 756 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c930210-929455 Proteus mirabilis BB2000, complete genome
ATGACTGATGATATTTTACTGAATCATGATGATGAAGAGCGCATTACAAAGAAAAATTACCAACTGCCGC
TAAGAGGAAACAACATCAATCCAATGATAGATGCGGCTACACCTTTATTAGGCATGGTATTGCGCATGAA
AGCGATGTCTGAAACCCCACTTTCAGAAAAGCTTTACCAACAAGTTGTCATGGATATTACCTCTATTGAG
CAACAATTACAGATCCAAGGTTACGAGCCAGGTGCCATTGTTTCATTTCGTTATGTGCTATGTACTTTTA
TTGATGAAACCGCCCTTGGATTAGGCTGGGATCAAGATAATGGTTGGGTAAAACAATCATTACTGGTTCA
TTTTCATAATGAATCATGGGGTGGTGAAAAAGTCTTTGTCTTAATTGAAAGATTATTAGGTGAACCTAAA
CGTTACCTCGATCTGATTGAATTTATCTACCTTTGTTTATGCCTAGGATACCGCGGGCGCTACAAAGTCT
CTGCGGGACAAAATGATGAATTTAATCATTTATTAAGACGCTTACAAAAACAGATCCAACAGCTAAGAGG
TAACGCTAAGCCAATAGTTCTATTTGAAAAAGGTGATAACCAACAAAGCCGTTATCGTTTAGGTAAGCGT
TTAGGGGCTCGCTATATTCTCATAGGTACAGCGGTATTCGCGTTGATTATTTATAGCATTTATTCATCCA
GACTGAATTATCAAACACTCAGTATTGTGGAACAACTTAATACTTTACTTGGCTAG