SecReT6
Protein ID: 529236512
SecReT6 ID838
T6SS typei1
Gene symboltssH
Locus tagBB2000_0814
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]930203..931561 [-]
ProductTssH
NoteTssK
UniProt IDS5URP7
KEGG IDpmib:BB2000_0814
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.30E-148, Aligned region: 19..446
Protein Sequence: 452 a.a.     [Download]
>gi|529236512|ref|YP_008397371.1| TssH [Proteus mirabilis BB2000]
MSTKNRVIWREGLFIKPQHFQQQQRHQDYMTVSILNNFFSHFWGFSTLKLSDDLYALGRIGIKEASGVMP
DGTIFSIPNQDLLPQPIDITNITDSDSSIIYLAFPLMNENVSEISTEHNGSRLLSRYSESTENIRDLHTE
NGDISAIHVAQLTPILKQGKHGLDAYVALPICRIRERNANGNLTLDNDYIPSLLNIRASTLLSQFLTELE
GTLYERGKQIASRIGAPGQQGVADVAEFMMLQVLNRTYPLYSHYAQEPVIHPEKLFRDLLELCGELQTFT
NTSRLPENIAKYQHAKLTESYIPLIASIREALSVVLTPRAIPIPLQVQEHGIRVATIHDKQLLQRAEFII
AVKSQMPQEQLRRQFPQQTKVTTINNIRSLVSVQIPGVPLSPLSAAPRQLPYHSGYNYFHFDQQGNEWKG
IQQDGNIAFHVSGNFPDLDIQLWAIRDGALYD
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c931561-930203 Proteus mirabilis BB2000, complete genome
ATGTCAACTAAAAATAGAGTGATCTGGCGTGAAGGGCTATTTATCAAACCTCAACATTTTCAGCAACAAC
AACGTCATCAAGATTATATGACGGTGAGTATTTTAAATAACTTTTTTTCACACTTTTGGGGATTTAGTAC
CTTAAAATTGAGTGACGATTTATATGCTTTAGGTCGTATTGGTATTAAAGAAGCTTCTGGTGTTATGCCA
GACGGCACCATTTTCTCTATACCAAACCAAGATTTACTACCACAGCCTATTGATATAACGAATATTACTG
ATAGTGACAGCAGTATTATTTATCTGGCTTTTCCTTTAATGAACGAGAATGTCAGTGAAATTTCCACTGA
ACATAACGGTAGTCGTTTACTTTCTCGCTACAGCGAAAGCACCGAAAATATTCGTGATTTACATACTGAA
AATGGTGATATCAGTGCTATTCATGTTGCACAGCTCACACCAATACTCAAACAAGGTAAACATGGTTTAG
ATGCCTATGTTGCTTTACCTATCTGTCGTATTAGAGAGCGTAATGCTAATGGTAATTTAACGCTAGATAA
TGATTATATTCCCAGCCTATTAAATATCCGTGCCTCAACATTATTGAGCCAATTTCTCACCGAGCTTGAA
GGAACGCTATATGAAAGAGGAAAACAAATTGCCTCTCGCATTGGTGCCCCGGGTCAGCAAGGTGTTGCGG
ATGTGGCAGAATTTATGATGTTACAAGTGCTTAATCGCACTTATCCACTCTATTCGCATTATGCTCAAGA
GCCGGTGATCCATCCTGAAAAACTATTTCGAGATTTATTAGAGCTTTGTGGTGAACTACAAACATTCACG
AATACTTCACGTTTACCTGAAAATATTGCCAAATATCAACATGCTAAATTAACAGAAAGTTATATTCCAT
TAATAGCCAGTATCCGCGAAGCACTCAGTGTTGTCTTAACACCAAGAGCGATCCCAATCCCGCTACAAGT
TCAAGAGCATGGTATTCGTGTAGCAACCATTCATGACAAACAACTGCTACAACGTGCTGAATTTATTATT
GCGGTGAAATCACAAATGCCGCAAGAGCAACTACGTCGCCAATTCCCACAACAAACTAAGGTGACAACAA
TCAATAACATTCGCAGCTTGGTTAGTGTGCAAATACCGGGTGTTCCTTTATCACCACTTTCGGCTGCACC
AAGACAATTACCTTATCACTCGGGATATAACTATTTCCATTTTGATCAACAAGGCAATGAATGGAAAGGG
ATCCAGCAGGATGGCAACATCGCATTCCACGTTTCAGGAAACTTCCCCGATCTCGATATTCAGTTATGGG
CAATAAGAGATGGAGCACTCTATGACTGA