SecReT6
Protein ID: 529236513
SecReT6 ID838
T6SS typei1
Gene symboltssG
Locus tagBB2000_0815
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]931563..932114 [-]
ProductTssG
NoteTssJ
UniProt IDS5U0V2
KEGG IDpmib:BB2000_0815
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-36, Aligned region: 16..175
Protein Sequence: 183 a.a.     [Download]
>gi|529236513|ref|YP_008397372.1| TssG [Proteus mirabilis BB2000]
MQLRTFSILLLFSSFLILSGCSKPFEAAGKMGKILLDPSTPVGQPKDQPSTVALTILAEPYINPNQEGEA
APINIQVVYLNEDSVFGSVDHDQIDAKEGDLEKVLKKNYIDHQDYTILPGQYKPFPTMTLDPSNRYIGII
AYYSDPDKAEWKKIVKARGKGRHYFLLVHIRENEIEFRQEEDD
 
Nucleotide Sequence: 552 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c932114-931563 Proteus mirabilis BB2000, complete genome
ATGCAGCTTAGAACTTTCTCAATATTACTGTTATTTAGCTCTTTTTTAATATTGAGTGGATGTAGTAAAC
CTTTTGAAGCCGCGGGTAAAATGGGGAAAATCTTATTAGATCCCTCAACTCCTGTTGGGCAACCGAAAGA
TCAGCCCTCTACCGTTGCATTAACCATCCTTGCGGAGCCCTATATTAATCCTAATCAGGAAGGTGAAGCT
GCGCCGATAAATATCCAAGTTGTTTATCTTAATGAAGATTCAGTATTTGGCTCTGTTGATCATGATCAGA
TAGATGCAAAAGAGGGTGACTTAGAGAAAGTTCTAAAGAAAAATTATATTGACCATCAAGACTACACCAT
TTTACCTGGCCAATATAAACCCTTCCCTACTATGACGTTAGACCCATCTAACCGTTACATTGGCATTATT
GCCTATTACTCAGATCCTGATAAAGCAGAATGGAAGAAAATAGTCAAAGCGCGTGGTAAAGGACGCCACT
ACTTCCTATTAGTGCACATTAGGGAAAATGAAATCGAATTTAGACAAGAAGAGGATGATTAA