SecReT6
Protein ID: 529236514
SecReT6 ID838
T6SS typei1
Gene symboltssF
Locus tagBB2000_0816
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]932116..933384 [-]
ProductTssF
NoteFha
UniProt IDS5UP65
KEGG IDpmib:BB2000_0816
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00027, Aligned region: 35..100
Protein Sequence: 422 a.a.     [Download]
>gi|529236514|ref|YP_008397373.1| TssF [Proteus mirabilis BB2000]
MDKYQPTISFSIKNSEQLESGYLPNATLTQSGGQIGSGNQCDWKIQDNEGAIADRQCTVFWKDQHFCLKV
NSGPVYINNAIIPLHLDAVRLTQGDQIKVGKLVIATNISLTGEPVQNMMAMTPQSIIAKDHNPLDSLFDV
DTTVKNERKEPPFVPTVQGALTTDPLQALENENLSLISKNTQATSDDPLLSDPHSYSSAFPTSDNQENTM
VQEFIDLPKITPNENEHMTDVDHVAVNPLMKGLGIHLNLTNTQHANDFLVELGKTVKAAIEGLLILQQQQ
ESLQDKQLRPIEDNPLRLNSGYEETMKLMFTDERSPVHLSAPAAVTESLHNIQLHYQANQEAISTALSTM
LAAFSPEHLLNRFSQYRRASDNTPMNDGWAWEMYNNYYKELSSSRQQGFEKLFYEVYSHAYDRALRKGIE
EA
 
Nucleotide Sequence: 1269 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c933384-932116 Proteus mirabilis BB2000, complete genome
ATGGATAAATATCAGCCAACAATTTCTTTTAGCATCAAAAATAGTGAACAGCTAGAAAGTGGTTATCTGC
CAAATGCGACTTTAACTCAAAGTGGCGGACAGATTGGTAGTGGCAATCAATGTGACTGGAAAATCCAAGA
TAATGAAGGTGCTATTGCCGATCGGCAATGTACGGTGTTTTGGAAAGATCAACACTTTTGCTTAAAAGTA
AATTCAGGTCCTGTTTACATTAATAATGCGATTATTCCATTGCATCTTGATGCCGTTAGACTGACCCAAG
GTGATCAGATAAAGGTGGGTAAATTAGTTATTGCCACCAATATTAGTCTTACCGGAGAGCCGGTACAAAA
TATGATGGCGATGACGCCTCAGTCTATTATCGCAAAAGATCATAATCCGCTAGATTCATTATTTGATGTT
GATACAACAGTCAAAAATGAGCGGAAAGAGCCTCCGTTTGTACCAACCGTTCAGGGGGCATTAACAACAG
ACCCACTACAGGCTTTAGAAAACGAAAATCTAAGCTTAATTTCTAAAAACACACAAGCTACTTCAGACGA
TCCTTTATTGAGTGACCCCCACTCGTATTCATCTGCCTTTCCGACATCAGATAATCAAGAGAATACTATG
GTCCAAGAATTTATTGATTTACCTAAAATCACACCTAATGAAAACGAACATATGACCGATGTCGATCATG
TGGCAGTTAACCCTCTGATGAAGGGATTAGGTATCCACCTTAATTTAACAAATACACAGCATGCTAATGA
TTTTCTTGTTGAACTGGGTAAAACCGTCAAAGCGGCTATTGAAGGTTTACTGATTTTGCAACAACAACAA
GAAAGCTTACAAGATAAGCAATTACGCCCAATTGAAGATAATCCTCTACGTCTTAATAGTGGCTATGAAG
AGACAATGAAGTTGATGTTTACCGATGAACGTAGCCCTGTACATCTTTCAGCACCAGCGGCAGTAACAGA
AAGCTTGCACAACATCCAATTGCATTATCAAGCGAATCAAGAAGCTATTTCAACCGCACTATCAACCATG
TTGGCAGCATTCTCTCCTGAACATTTATTAAACCGCTTTTCTCAGTATCGACGAGCTTCAGATAACACAC
CAATGAATGATGGCTGGGCTTGGGAAATGTACAACAACTATTACAAAGAACTCTCTTCATCTCGGCAACA
GGGTTTTGAAAAATTATTCTATGAAGTATACAGCCATGCTTATGACAGAGCGCTGAGAAAAGGAATAGAG
GAAGCTTAA