SecReT6
Protein ID: 529236515
SecReT6 ID838
T6SS typei1
Gene symboltssE
Locus tagBB2000_0817
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]933389..934426 [-]
ProductTssE
NoteTssG
UniProt IDS5TYW3
KEGG IDpmib:BB2000_0817
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-85, Aligned region: 24..332
Protein Sequence: 345 a.a.     [Download]
>gi|529236515|ref|YP_008397374.1| TssE [Proteus mirabilis BB2000]
MASTNQPAHTEVIDRWLEQAGSSVTEYNFYQLVELLNKIIHQDVNSMEDDSGILRFKSYSNIAFPTRDVI
SIEKNNVEQYELEVAFLGLQGSQSPLPGYYLDEFAWEDAQQIEGISAFLDIFNHRLIALLYRIWRKYRYY
ICFENEGQDSFSQYMFSLVGLGNGANRGRIKINHSKMLAYAGLLASPSRSSDVISSLISHCFDLENVKVI
GWETRRVPIPESQQNKLGTISHQSGQKSRPRMLLGENFSLGSHIYDCNGKCTIEISELSLERYMRFLPNG
SDFAPLVAFVSYIFHEQLAWDLRLSIAEKQAEGFRLGHQQHNQLGWQSFLGQPAKKPDVTITVLE
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c934426-933389 Proteus mirabilis BB2000, complete genome
ATGGCCAGCACAAATCAACCAGCACATACTGAAGTAATCGATCGTTGGCTGGAACAAGCTGGCTCATCGG
TAACAGAGTATAATTTTTATCAACTCGTTGAATTGTTAAATAAAATAATTCATCAAGATGTCAACTCGAT
GGAGGATGACAGCGGTATTCTTCGCTTTAAATCTTATTCAAATATTGCATTTCCGACGCGAGATGTCATT
TCCATTGAAAAAAATAATGTCGAACAATATGAATTAGAAGTCGCTTTTTTGGGCTTACAAGGAAGTCAGT
CCCCCCTACCAGGCTATTATCTGGATGAGTTTGCTTGGGAAGATGCACAACAGATAGAAGGTATCTCCGC
TTTTCTCGATATCTTCAATCATCGTCTGATAGCGTTACTTTATCGGATCTGGCGCAAATATCGTTACTAC
ATTTGCTTTGAAAATGAAGGTCAGGATTCATTTTCACAATATATGTTTTCTCTCGTTGGATTAGGTAATG
GAGCTAATCGCGGTCGGATCAAAATCAACCATAGCAAAATGCTCGCTTATGCTGGTCTTTTGGCGAGTCC
AAGTCGCTCTTCTGATGTGATTAGTAGTCTTATATCTCACTGTTTCGACTTAGAAAATGTAAAAGTAATT
GGTTGGGAGACACGCCGTGTTCCTATTCCTGAATCACAACAAAACAAGTTAGGTACGATTTCTCATCAAT
CCGGACAAAAATCTCGCCCACGAATGTTATTAGGGGAGAATTTTAGTCTGGGCTCACACATATATGATTG
CAATGGAAAATGCACCATCGAAATCAGTGAATTAAGTTTAGAACGCTATATGCGTTTTTTACCTAACGGC
AGTGATTTCGCACCATTAGTTGCCTTTGTTTCTTACATTTTTCATGAGCAATTAGCTTGGGATTTACGTC
TTAGCATTGCTGAAAAGCAAGCCGAAGGGTTCCGTTTGGGTCACCAACAACACAACCAATTAGGCTGGCA
AAGCTTTTTAGGTCAACCCGCAAAGAAACCGGATGTCACCATTACGGTATTGGAATAA