SecReT6
Protein ID: 529236516
SecReT6 ID838
T6SS typei1
Gene symboltssD
Locus tagBB2000_0818
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]934390..936165 [-]
ProductTssD
NoteTssF
UniProt IDS5U8G2
KEGG IDpmib:BB2000_0818
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.80E-149, Aligned region: 5..590
Protein Sequence: 591 a.a.     [Download]
>gi|529236516|ref|YP_008397375.1| TssD [Proteus mirabilis BB2000]
MSSKSYFTNESEYLNELTEQVAKEKPQLVNLLSHNVKDPDTSRIMDGLSYLSGNLRQQIDRQFPELTNSL
ANMLWPNYARPVPSMTIVEYHPNYAQCQHATKISAGQPFSATPLYVQSEETNHETLFQCRFSQSRDLWLM
PTKISNILQQTTAIEITFELATKQPLANIGLDKLCFYLNGAPFTTNQLYFLLSQHVQSASLVTDVHTLPL
THFSVTPVGFQKQDALLPYPKNSYDGYRILQEFFCFPEAFLFLDIHGLDDIPLAIEAEQFKLVINFDLEI
PDGVILYDDSIKLNCTPIVNLFPIDSEAINLTGKSEEYVLSPNYQLTECFDIFSINEVRGLRYPNDAKPY
PITYTAFESFYHQNHQTQNHGYYRLKISQNEQLYGYSHRLSFVRQQEPQLQQCEETVSVALNCTNRYIAS
QLSTRSIDLDSASIPYGALSAKNLFAPTLPLYPLLDKTLYWSELTNLSLNYQSLLNLDSLKKILQLYDLP
SVYNTQVARQSQKRLDALVDLHSEHIEHIYKGLPVRGLKTTLVVHQNAFLSEGSLFLFCTVIAQFFTLYT
SINMFHELEVINLDNKEVYRWPAQINQHILK
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c936165-934390 Proteus mirabilis BB2000, complete genome
ATGTCATCAAAATCCTACTTTACCAATGAATCAGAATACTTAAATGAGCTGACTGAGCAAGTTGCCAAAG
AAAAACCGCAACTTGTTAATTTGCTTTCGCACAATGTTAAAGATCCTGATACTTCGCGGATTATGGATGG
GCTATCTTATTTATCGGGTAATTTACGCCAGCAAATAGATAGACAATTTCCTGAGTTAACTAACAGTTTA
GCCAATATGCTTTGGCCAAACTACGCGCGCCCTGTGCCAAGCATGACGATTGTTGAATATCATCCTAATT
ATGCTCAGTGCCAACACGCAACAAAAATTTCAGCAGGACAACCTTTTAGTGCCACTCCACTTTATGTGCA
AAGTGAGGAAACAAACCACGAGACGTTATTTCAATGTCGATTTAGTCAAAGTCGCGACCTCTGGTTAATG
CCGACAAAAATCAGTAACATTTTGCAGCAAACAACCGCCATTGAAATAACATTTGAGTTAGCAACAAAAC
AGCCACTTGCCAATATTGGCTTAGATAAATTGTGTTTTTACTTAAATGGTGCGCCATTTACTACAAATCA
GCTCTATTTTTTATTAAGCCAGCATGTGCAGAGTGCCTCTTTAGTCACAGATGTACATACGCTACCTCTT
ACTCACTTTTCAGTTACGCCTGTTGGTTTTCAAAAGCAGGATGCCTTACTTCCATACCCGAAAAATAGCT
ATGATGGCTATCGTATACTGCAAGAGTTTTTCTGTTTTCCTGAAGCCTTTCTCTTTCTAGATATTCATGG
TTTGGATGACATTCCTTTGGCTATCGAAGCAGAGCAATTCAAACTGGTGATCAATTTTGATCTAGAAATT
CCTGATGGCGTTATTCTTTACGACGACAGTATTAAACTTAATTGCACCCCTATTGTGAATTTATTTCCTA
TTGATAGTGAAGCAATAAATTTGACGGGGAAAAGTGAGGAGTATGTTTTAAGTCCTAATTACCAACTTAC
TGAATGTTTTGATATTTTTTCGATTAATGAGGTTAGAGGGTTACGTTATCCTAATGATGCTAAACCTTAT
CCGATCACCTATACAGCATTTGAAAGTTTTTATCATCAAAACCATCAGACTCAAAATCATGGCTATTACC
GTTTAAAGATAAGTCAAAATGAACAGTTATACGGCTATTCCCATCGACTTTCTTTTGTTCGTCAGCAAGA
GCCTCAGTTACAACAGTGTGAAGAAACCGTTTCTGTTGCACTCAACTGTACTAACCGCTATATCGCTTCC
CAGTTATCGACGCGTTCTATCGATTTAGATAGTGCATCAATTCCTTATGGGGCTTTATCTGCTAAGAATT
TATTCGCACCAACACTGCCTTTATATCCATTATTAGATAAAACATTATATTGGTCTGAATTAACTAATTT
ATCTTTAAATTATCAGTCTTTGCTCAATCTTGATTCATTAAAAAAAATATTACAACTCTATGATTTACCG
TCTGTTTATAACACACAGGTTGCAAGGCAATCACAAAAACGCCTAGATGCATTAGTTGATTTACATTCAG
AGCATATTGAGCATATCTACAAAGGCCTTCCTGTTCGCGGTCTGAAGACAACGTTAGTTGTTCATCAAAA
TGCGTTTCTTTCGGAAGGAAGTTTATTCCTATTTTGTACCGTTATCGCTCAATTTTTCACCTTATATACC
AGCATTAATATGTTTCATGAGTTGGAAGTTATTAACCTTGATAATAAGGAAGTTTATCGATGGCCAGCAC
AAATCAACCAGCACATACTGAAGTAA