SecReT6
Protein ID: 529236517
SecReT6 ID838
T6SS typei1
Gene symboltssC
Locus tagBB2000_0819
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]936173..936604 [-]
ProductTssC
NoteTssE
UniProt IDS5URQ4
KEGG IDpmib:BB2000_0819
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.00E-16, Aligned region: 32..125
Protein Sequence: 143 a.a.     [Download]
>gi|529236517|ref|YP_008397376.1| TssC [Proteus mirabilis BB2000]
MASNYGWQANAGASLFERIRGKNLGFSHRSRTNTLIESIKQNLNYILNARPDGCQGTPPLGIPDLNDATQ
STVDFKSHLEDSISSCIIAYEPRISKVVVKFLEEDADSLSLQFNINAFIDLENKQQLIEFNVYLDNNRRY
QLK
 
Nucleotide Sequence: 432 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c936604-936173 Proteus mirabilis BB2000, complete genome
ATGGCATCCAATTATGGCTGGCAGGCTAATGCTGGCGCCAGCTTATTTGAACGGATCCGAGGGAAAAACT
TAGGTTTTTCCCATCGTTCGCGAACAAATACACTCATTGAATCAATAAAACAAAATTTAAATTACATCTT
AAATGCTAGACCTGATGGTTGCCAAGGAACGCCACCCTTAGGGATCCCTGATTTAAATGATGCGACTCAA
TCTACGGTTGATTTTAAATCTCACCTAGAAGATAGCATTAGTAGTTGCATTATTGCGTATGAACCACGGA
TCAGCAAAGTTGTAGTGAAATTTCTTGAAGAAGATGCAGATAGTTTATCTTTACAATTTAATATTAATGC
TTTTATTGATTTAGAAAATAAGCAGCAACTTATTGAATTTAATGTGTATTTAGATAATAACCGTAGATAT
CAGCTTAAATAG