SecReT6
Protein ID: 529236518
SecReT6 ID838
T6SS typei1
Gene symboltssB
Locus tagBB2000_0820
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]936610..938088 [-]
ProductTssB
NoteTssC
UniProt IDS5U0V6
KEGG IDpmib:BB2000_0820
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.00E-185, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|529236518|ref|YP_008397377.1| TssB [Proteus mirabilis BB2000]
MSLNAEAQEQQAPASTGSLLDEIMAQSRMSPETEAYDIAKQGVAAFISNIFASESEDQQINRLLIDKMLV
ELDNKLSTQVDEILHAPKFQEIEASWRSLKLLVDRTDFRENIKINILHATKEELLEDFEFSPEIVQSGFY
QHVYSSGYGQFGGEPVATVIGNYAFNNTAPDMKLMQYVSTVGAMAHAPFLSSVSPNFFGINSYAELPAIK
DLKSVFEGPAHTKWRSLREAEDSRYLGLTAPRFLLRLPYSPTENPVKMFNYSENVKQDHEHYLWGNTAFL
LASCINDSFAKYRWCPNIIGPQSGGTVNDLPVHIFEAMGELQTKIPTEVLVTDRREFELAEEGFITLTMR
KGSDNAAFFSANSVQKPKVFPNTPEGKLAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNIWLKQYVADQENPPADVRSKRPLRSAEIKVLDVDGDPGWYQVAIQVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c938088-936610 Proteus mirabilis BB2000, complete genome
ATGTCACTAAATGCAGAAGCTCAAGAGCAACAAGCCCCCGCATCTACAGGCTCTTTACTTGATGAAATTA
TGGCTCAATCACGTATGTCTCCAGAAACAGAAGCATACGATATTGCCAAACAAGGTGTTGCTGCTTTTAT
TAGTAATATTTTCGCCAGTGAATCTGAAGACCAACAGATCAATCGATTATTAATCGATAAAATGCTTGTT
GAACTTGATAATAAACTAAGTACTCAAGTTGACGAAATTCTTCACGCGCCTAAATTTCAAGAAATTGAAG
CTTCATGGCGTTCTTTAAAATTACTCGTTGATCGCACTGATTTTAGAGAAAATATTAAGATCAATATTCT
TCATGCAACTAAAGAAGAGTTATTAGAAGATTTTGAATTTTCTCCAGAAATTGTTCAATCAGGCTTCTAT
CAACACGTCTACTCTTCAGGATACGGCCAATTTGGTGGTGAACCTGTTGCAACAGTTATTGGTAACTACG
CCTTTAACAATACTGCGCCAGATATGAAGTTAATGCAGTATGTTAGTACTGTTGGTGCAATGGCTCACGC
GCCATTCCTATCATCTGTTTCACCTAATTTCTTTGGTATTAATAGCTACGCTGAACTGCCGGCAATTAAA
GATCTAAAATCTGTTTTTGAAGGCCCTGCACACACTAAATGGCGCTCACTGCGTGAAGCAGAAGATTCCC
GTTATTTAGGGTTAACAGCACCGCGTTTCTTATTACGTTTGCCATACTCTCCAACAGAAAACCCTGTAAA
AATGTTTAACTATTCAGAAAATGTTAAACAAGACCATGAGCACTATTTATGGGGTAATACCGCATTCTTA
TTAGCAAGCTGTATTAATGATAGTTTTGCAAAATATCGTTGGTGTCCAAACATTATTGGCCCACAAAGCG
GCGGTACAGTTAATGATCTTCCTGTGCATATTTTTGAAGCGATGGGTGAATTACAAACTAAGATCCCAAC
TGAAGTTTTAGTTACCGATCGTAGAGAATTTGAACTAGCAGAGGAAGGCTTTATCACGCTGACCATGCGT
AAAGGCAGTGATAATGCTGCATTCTTCTCAGCAAACTCGGTTCAAAAACCAAAAGTCTTCCCAAATACTC
CTGAAGGCAAATTGGCAGAGACTAACTATAAGTTAGGAACTCAATTGCCATACATGTTTATTATCAATCG
CTTAGCTCATTATATAAAAGTATTGCAACGTGAACAGATTGGCTCATGGAAAGAGCGTCAAGATCTGGAG
CGTGAACTCAATATTTGGCTTAAGCAATATGTCGCAGATCAAGAAAACCCACCAGCAGATGTTCGTAGTA
AACGTCCATTGCGTTCAGCTGAAATCAAAGTACTTGATGTTGATGGCGATCCAGGTTGGTACCAAGTCGC
TATTCAAGTTCGCCCACATTTTAAATATATGGGTGCAAACTTTGAATTATCACTTGTTGGTCGTCTTGAT
AAAGAGTAA