SecReT6
Protein ID: 529236519
SecReT6 ID838
T6SS typei1
Gene symboltssA
Locus tagBB2000_0821
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]938109..938609 [-]
ProductTssA
NoteTssB
UniProt IDS5UP69
KEGG IDpmib:BB2000_0821
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.40E-60, Aligned region: 8..160
Protein Sequence: 166 a.a.     [Download]
>gi|529236519|ref|YP_008397378.1| TssA [Proteus mirabilis BB2000]
MSKKNLGSVAPKERINIKYTPNTGGAQAEVELPLNMLIVGDMKGKTEETPIEDRKAISVNQNNFNSVMES
AGINLNINVRNTLEESSDSELNVNLDVKSLQDFSPDSIARQVPELNKLLELREALVALKGPLGNVPAFRK
RLQELLENQETREQLLKELDIAANQK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|529235720|ref|NC_022000.1|:c938609-938109 Proteus mirabilis BB2000, complete genome
ATGAGTAAGAAAAATCTCGGTAGTGTTGCCCCTAAAGAAAGGATTAATATTAAATATACGCCAAATACTG
GCGGAGCTCAGGCTGAAGTCGAACTTCCATTGAATATGTTGATTGTTGGGGATATGAAAGGTAAAACGGA
AGAGACCCCCATTGAAGATCGCAAAGCGATTTCAGTCAATCAAAACAACTTCAATTCTGTTATGGAAAGT
GCTGGCATTAATTTAAATATTAATGTTCGCAATACCTTAGAAGAAAGCAGTGATTCAGAGCTTAATGTTA
ACCTTGATGTGAAATCTTTACAGGATTTCTCTCCTGATAGTATCGCTCGCCAAGTGCCCGAATTAAATAA
ACTTCTCGAATTGCGTGAAGCTTTAGTTGCATTAAAAGGTCCTCTAGGCAATGTCCCAGCTTTTAGAAAG
CGTCTTCAAGAACTACTTGAAAATCAAGAAACTCGCGAACAGCTTCTAAAAGAGCTCGATATTGCTGCTA
ATCAAAAATAA