SecReT6
Protein ID: 529236521
SecReT6 ID838
T6SS typei1
Gene symbolidrB
Locus tagBB2000_0823
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]941108..943300 [+]
ProductIdrB
NoteTssI
UniProt IDS5U8H0
KEGG IDpmib:BB2000_0823
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-51, Aligned region: 130..421
Phage_base_V [PF04717], Evalue: 5.10E-19, Aligned region: 463..551
Protein Sequence: 730 a.a.     [Download]
>gi|529236521|ref|YP_008397380.1| IdrB [Proteus mirabilis BB2000]
MLSKDPKSTPIDPASVLKDEAINQVKNRVQSKVNETLSTPTQKVAGMASAAASLTQSASASANRVTAHPL
IHGGGFTGGQTFAENQALQAAHGALLDALGMDSLESGLVFTCTIGGLPDDTFQVTEFNLTEGLSSLFSLS
ISAVSALPFIDFQRHLGLASSLTVKRDGVLIRKVNGILAGAVQGNTDGVKTWYHFDIRPEMWVMTLNQDS
RIFQHQSVPTILKTLLDEAHVKADCQFYREDLHPERLYTTQKRESAFDFWCRLAFEEGINFWFEEEQLFY
SDEHMGMTAGIHLTYNPQADTDISDSTAMTWQYGEYLCVDETIHKDNNFVRPSYPLSHENKIEQGGQHSV
FESYGRFQLDDEGRPLTQVRFEQLRNGSKVGQATTNCFALMPGKIFTLSQHPHQPMNDRWQVISVSHHGV
QPLADNSGGEGTQLSNSVSFIPGTQEWRPPYRYKPTADGDEVATVVGPPGEEIYVNEYGAVKVHFHWDRR
GSADHSASCWVRVAMGWSGNGYGFSAVPRIGTQVLVSYLNGDIDRPMITGCTYDGRNAPPIKFPENKTQT
TFRSQTHKGEGFNELRFEDAGGKQEVFLHAQKDMNTVVQNDKGTTVGANHTETIMQNQKISVHGTQTTAV
QADQKNIVFGNQHSIVDGEVLIASAKGIRLISGNSALQLNPDGTITLVCNNFDFYGHGSGRIGTGELLDL
NMDGAGPGNLEMKPDTSTIAQAKDQFFPKK
 
Nucleotide Sequence: 2193 bp     [Download]
>gi|529235720|ref|NC_022000.1|:941108-943300 Proteus mirabilis BB2000, complete genome
ATGCTTAGCAAAGATCCGAAATCAACGCCCATTGACCCGGCATCCGTTTTAAAAGATGAAGCCATCAATC
AAGTGAAAAATAGGGTGCAATCCAAAGTGAACGAAACGCTATCGACACCCACGCAAAAGGTGGCCGGGAT
GGCCTCAGCAGCGGCCTCGCTCACTCAATCAGCCAGCGCATCGGCCAATCGCGTGACGGCTCATCCCCTG
ATCCACGGTGGCGGTTTTACCGGTGGACAAACATTCGCTGAAAACCAAGCACTCCAAGCGGCCCATGGGG
CGTTACTTGATGCATTAGGCATGGACAGCCTCGAAAGTGGTTTGGTGTTCACTTGCACCATTGGTGGATT
GCCTGACGACACCTTTCAAGTCACCGAATTTAATCTTACCGAAGGATTATCCTCGCTATTTTCGCTGTCC
ATCAGTGCGGTCAGTGCCTTACCCTTTATCGATTTTCAGCGCCATCTTGGCTTAGCCTCATCATTAACGG
TCAAACGCGATGGGGTGTTGATCCGCAAAGTCAACGGTATCTTAGCCGGGGCAGTACAAGGCAATACCGA
CGGAGTGAAAACGTGGTATCACTTCGATATTCGCCCTGAAATGTGGGTGATGACCCTCAATCAAGACAGC
CGTATTTTTCAACATCAATCGGTGCCGACCATCTTAAAAACCTTATTGGATGAGGCCCATGTTAAAGCGG
ATTGCCAATTCTACCGTGAAGATCTACACCCTGAACGTCTCTACACCACCCAAAAACGCGAATCGGCATT
TGATTTTTGGTGTCGACTGGCGTTTGAAGAGGGCATTAACTTCTGGTTTGAAGAAGAACAACTGTTTTAC
AGCGATGAACATATGGGGATGACGGCGGGTATTCACCTCACCTATAACCCGCAGGCCGACACCGATATCA
GCGATAGCACTGCCATGACTTGGCAATATGGCGAATATTTGTGTGTGGATGAAACTATCCATAAAGACAA
CAACTTTGTTCGTCCTTCTTATCCGTTGTCTCATGAAAACAAAATTGAGCAGGGGGGACAGCACAGTGTG
TTTGAAAGTTATGGTCGTTTTCAATTAGACGATGAAGGTCGACCTCTGACACAGGTGCGCTTTGAGCAAT
TACGTAACGGCAGCAAAGTGGGGCAAGCGACAACAAACTGTTTTGCGCTGATGCCCGGCAAAATCTTCAC
CTTATCTCAGCATCCCCATCAGCCGATGAATGATCGCTGGCAAGTGATCAGCGTCAGCCATCATGGTGTA
CAGCCACTGGCGGACAATAGCGGGGGCGAAGGCACACAACTGTCGAATAGCGTCTCCTTTATTCCGGGCA
CGCAAGAGTGGCGTCCCCCTTATCGTTATAAACCGACTGCCGACGGCGATGAAGTGGCGACGGTGGTAGG
ACCGCCGGGGGAAGAAATCTACGTCAATGAATATGGCGCCGTGAAAGTGCATTTTCATTGGGATCGTCGG
GGAAGTGCCGATCACAGTGCTTCATGCTGGGTGCGGGTTGCCATGGGTTGGAGTGGAAATGGCTATGGTT
TTTCTGCGGTACCGCGCATCGGCACACAAGTGCTGGTCAGTTACCTGAATGGGGATATCGACAGACCGAT
GATTACCGGTTGTACCTATGATGGTCGTAACGCACCACCGATTAAGTTCCCAGAGAATAAGACACAAACC
ACTTTCCGTAGCCAAACCCACAAAGGGGAAGGTTTTAATGAACTGCGTTTTGAAGATGCCGGCGGTAAGC
AAGAGGTGTTTCTTCATGCGCAGAAGGATATGAATACCGTAGTCCAAAACGATAAAGGAACGACGGTAGG
CGCCAATCATACTGAAACCATTATGCAAAACCAAAAGATCTCAGTACATGGTACGCAAACTACGGCGGTT
CAAGCGGATCAAAAAAATATCGTGTTTGGTAATCAACATTCAATCGTGGATGGTGAAGTGTTGATCGCAT
CAGCCAAAGGTATTCGTTTAATTAGTGGCAACTCGGCACTTCAATTAAACCCTGACGGGACTATCACCTT
AGTGTGTAACAACTTTGATTTTTACGGTCACGGTAGCGGTCGGATTGGTACTGGTGAGTTATTAGATTTG
AATATGGACGGGGCAGGTCCCGGAAACCTTGAGATGAAACCCGATACTAGCACTATCGCTCAAGCGAAAG
ATCAGTTTTTCCCTAAAAAATAA