SecReT6
Protein ID: 529987971
SecReT6 ID805
T6SS typei2
Gene symbol-
Locus tagKPR_2378
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]2475192..2475683 [+]
Producthypothetical protein
NoteTssB
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-51, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|529987971|ref|YP_007991357.1| unnamed protein product [Klebsiella pneumoniae]
MADTFQNEVPRARINLKLSLHTGGAQKKIELPLKLLTIGAFSHGKENRPLSEREKINVNKNNFNSVLSEF
SPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|529985600|ref|NC_021232.1|:2475192-2475683 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCG
GCGCGCAAAAGAAGATCGAACTGCCGCTCAAGCTGCTTACCATTGGCGCTTTTAGTCATGGGAAGGAAAA
CCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAATTTTAACAGCGTACTTTCGGAATTT
AGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGGCCGGCAATGGCGAAGAGGAGAACGTCAGACTGC
GTTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCGCAACTCCGCGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTCGATAACGCCACTTTCAGAAAAGAGCTT
GAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTTGCCCCGAAAT
AA