SecReT6
Protein ID: 529987973
SecReT6 ID805
T6SS typei2
Gene symbol-
Locus tagKPR_2380
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]2477280..2478623 [+]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-135, Aligned region: 19..444
Protein Sequence: 447 a.a.     [Download]
>gi|529987973|ref|YP_007991359.1| unnamed protein product [Klebsiella pneumoniae]
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQ
DGTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAERPARFRQRWRDVRNQFGDDT
RQIAVIQPELTLRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLATQLEQLLVQLRA
RLTRLMAMRRESNERMADFAVADVSLFWLRNALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSL
THQANAVPIYQHDQLNAVFPPLFDLLSDLLEASLPSQVVAIALEHDARLHFWQARLHDARLREGADYYLS
VRSSVPVAQLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|529985600|ref|NC_021232.1|:2477280-2478623 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCTCAGCATTTTCAACAGCAGG
CTGCGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATGGGTCTTAACCACCCCTGGGGAGTGGTTGA
GGCGACCTTCGAACCAGAGATGCTCAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAG
GATGGCACGATGATTGATACGGACAATGCCGATGCGCTGCCGTCCGCGCTGTCGCTGGACGGCGCGTCCG
GCGAGGCGGTGATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGTCTGAAGCCGGAGGA
GGTGGCCGAAAGGCCGGCGCGCTTCCGGCAGCGCTGGCGCGATGTCCGTAACCAGTTTGGGGATGATACC
CGGCAGATTGCCGTCATACAGCCGGAGCTGACCCTCCGCTTCGCCCACCAGGACAACAGCGATTACCTGA
CCTGTCCGCTTGTTCGCCTGCAGCGGGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCCCGCC
GCTGCTGCAGATCCAGGGCAGCCGCTGGCTGGCGACGCAGCTTGAACAGCTGCTCGTCCAGCTCCGGGCT
CGTCTGACGCGCCTGATGGCCATGCGTCGCGAAAGCAATGAACGGATGGCTGATTTTGCCGTGGCTGATG
TCTCTCTGTTCTGGTTGCGGAATGCGCTGAACAGCGCCGAGCCGGTGCTGGGGTACTTTCTGCGTTACCG
GCAAAGCCCGCCGGAACGCCTCTACCCGGAGCTGGCGCGCCTGGCTGGTAGCCTGCTGACCTTTTCGCTC
ACCCATCAGGCGAATGCCGTCCCGATCTATCAGCATGACCAGCTGAACGCGGTTTTTCCGCCGCTGTTTG
ATTTACTGAGCGACCTGCTGGAGGCGAGCCTGCCATCGCAGGTGGTGGCGATTGCGCTGGAGCATGATGC
CCGGCTGCACTTCTGGCAGGCGCGTCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTACCTGTCG
GTTCGTTCGTCGGTACCGGTCGCCCAACTGCAGGAGCAGTTTCCGCGCCAGTGCAAAGTGGGCAGTCCGG
ATCATGTCAAAGCCATCGTCAACTCCTCGCGGACAGGGGTGCCCCTCACGCCATTGCGTCATGTGCCGGC
GGCGATCCCGCTGCGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCAACGGAAATG
CTGCAGAGCGGCACCTGTATGTTTTACGTCCCGGGGATGCTCGGTGAGCCTGAACTTGAACTTTTTGCGG
TACTACGAACGTGA