SecReT6
Protein ID: 529987974
SecReT6 ID805
T6SS typei2
Gene symbol-
Locus tagKPR_2381
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]2478620..2479309 [+]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|529987974|ref|YP_007991360.1| unnamed protein product [Klebsiella pneumoniae]
MNEPKRGNAASIDIDALLQNTWLQVISLRHGPQFRDEEGYTLWQRCIADVERVQHELKASGLDDASCQHI
LTAQCALLDEAVKGRGVEDEACLQWYDIPLQGHFLGTMDAGDTLCERMRDVLREPAPNLAVVTCFQRVML
LGFIGSFRSLHDPERLKLVNALSERVPPFQCPATAPVLVESRTGLGISGWLAPWPVRIGLSVVVVLALWW
GLNHWLDHLLLTLLPGEVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|529985600|ref|NC_021232.1|:2478620-2479309 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
GTGAATGAGCCTAAACGCGGCAACGCCGCGTCCATTGATATTGATGCGCTGCTGCAGAACACCTGGCTGC
AGGTTATCAGCCTGCGCCATGGCCCGCAGTTCCGCGATGAGGAAGGGTACACGCTATGGCAGCGCTGTAT
TGCTGATGTCGAGCGCGTGCAACATGAGCTGAAGGCGAGCGGGCTTGATGACGCCAGCTGTCAGCATATT
CTCACCGCCCAGTGCGCGCTGCTCGATGAAGCCGTGAAAGGTCGCGGCGTGGAGGATGAGGCCTGCCTGC
AGTGGTATGACATTCCGCTGCAGGGGCACTTCCTCGGCACCATGGACGCCGGCGACACCCTGTGCGAGCG
GATGCGTGATGTGTTGCGTGAACCGGCGCCCAACCTGGCCGTGGTCACCTGTTTTCAGCGGGTGATGCTG
CTGGGTTTTATTGGCAGCTTTCGCTCCCTCCACGACCCCGAGCGCCTGAAGCTGGTCAACGCGCTCAGTG
AGCGTGTTCCTCCTTTTCAGTGCCCGGCTACCGCTCCCGTACTGGTAGAGAGTCGCACCGGTCTGGGGAT
AAGCGGCTGGCTGGCCCCATGGCCGGTACGTATTGGCCTGAGCGTGGTGGTGGTACTCGCCCTGTGGTGG
GGACTCAACCACTGGCTCGATCACCTGCTGCTGACCTTGTTACCGGGGGAGGTGAAATGA