SecReT6
Protein ID: 529987977
SecReT6 ID805
T6SS typei2
Gene symbol-
Locus tagKPR_2384
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]2481773..2484427 [+]
Producthypothetical protein
NoteTssH
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.10E-40, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 3.10E-40, Aligned region: 610..775
AAA [PF00004], Evalue: 2.60E-20, Aligned region: 238..350
AAA [PF00004], Evalue: 2.60E-20, Aligned region: 615..736
AAA_5 [PF07728], Evalue: 3.00E-15, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 3.00E-15, Aligned region: 614..734
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 139..156
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 215..260
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 451..511
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 585..651
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 678..709
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 754..799
ClpB_D2-small [PF10431], Evalue: 7.90E-12, Aligned region: 383..406
ClpB_D2-small [PF10431], Evalue: 7.90E-12, Aligned region: 784..855
AAA_25 [PF13481], Evalue: 5.10E-09, Aligned region: 238..312
AAA_25 [PF13481], Evalue: 5.10E-09, Aligned region: 610..643
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 1.70E-08, Aligned region: 611..636
AAA_19 [PF13245], Evalue: 4.20E-08, Aligned region: 235..260
AAA_19 [PF13245], Evalue: 4.20E-08, Aligned region: 610..636
Arch_ATPase [PF01637], Evalue: 7.60E-07, Aligned region: 216..253
Arch_ATPase [PF01637], Evalue: 7.60E-07, Aligned region: 290..387
Arch_ATPase [PF01637], Evalue: 7.60E-07, Aligned region: 607..630
Arch_ATPase [PF01637], Evalue: 7.60E-07, Aligned region: 684..697
IstB_IS21 [PF01695], Evalue: 2.70E-06, Aligned region: 232..298
IstB_IS21 [PF01695], Evalue: 2.70E-06, Aligned region: 614..634
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 4.10E-06, Aligned region: 600..654
NACHT [PF05729], Evalue: 4.30E-06, Aligned region: 238..277
NACHT [PF05729], Evalue: 4.30E-06, Aligned region: 614..639
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 238..302
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 613..649
Sigma54_activat [PF00158], Evalue: 3.10E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 3.10E-05, Aligned region: 614..731
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 22..58
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 105..121
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 238..335
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 612..696
AAA_18 [PF13238], Evalue: 0.0004, Aligned region: 238..260
AAA_18 [PF13238], Evalue: 0.0004, Aligned region: 615..644
AAA_33 [PF13671], Evalue: 0.00085, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.00085, Aligned region: 394..437
AAA_33 [PF13671], Evalue: 0.00085, Aligned region: 613..635
RNA_helicase [PF00910], Evalue: 0.00096, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.00096, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.00096, Aligned region: 712..732
RNA_helicase [PF00910], Evalue: 0.00096, Aligned region: 850..883
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 610..638
AAA_23 [PF13476], Evalue: 0.0028, Aligned region: 238..255
AAA_23 [PF13476], Evalue: 0.0028, Aligned region: 441..530
AAA_23 [PF13476], Evalue: 0.0028, Aligned region: 611..638
ResIII [PF04851], Evalue: 0.0032, Aligned region: 223..260
ResIII [PF04851], Evalue: 0.0032, Aligned region: 308..320
ResIII [PF04851], Evalue: 0.0032, Aligned region: 586..642
AAA_28 [PF13521], Evalue: 0.0042, Aligned region: 238..262
AAA_28 [PF13521], Evalue: 0.0042, Aligned region: 614..634
AAA_30 [PF13604], Evalue: 0.0099, Aligned region: 235..258
AAA_30 [PF13604], Evalue: 0.0099, Aligned region: 611..636
DUF258 [PF03193], Evalue: 0.0099, Aligned region: 227..255
DUF258 [PF03193], Evalue: 0.0099, Aligned region: 525..566
DUF258 [PF03193], Evalue: 0.0099, Aligned region: 613..626
DUF258 [PF03193], Evalue: 0.0099, Aligned region: 791..836
Protein Sequence: 884 a.a.     [Download]
>gi|529987977|ref|YP_007991363.1| unnamed protein product [Klebsiella pneumoniae]
MENPASLLRRLNPCCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLL
SWLDKQPRSVRHRPQLSDHTLRLMQEAWLIASLSGEAQIRSVHLLMALVEKQNLIQCDGLWPLLTLGQRQ
LERLRPLLDAQSDERPPAQQEAALAQPHGGDVEFVGRPAGSELNADGLNPALQNALDKFTLDVTAKARDG
LIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDALKPVSVRTLDLGLL
QAGAGVKGEFEQRLKNIIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYADHHGVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTASARLRMSLDTVPEPLTRMKAQLTALAMEKQALLEDIALGNSARGDRLAAIEQEEIRLI
LALDTLETQYGQELQLTEALLACRRDISRQAEISDLQTALIAVQQGNPLLGLDVDVRTVATVIADWTGVP
LSSLMKDEQTELLSLEESLGKRVVGQQAALSAIARRLRAAKTGLTPENGPQGVFLLVGPSGTGKTETALA
LADALFGGEKALITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGVMRDGEGREIDFRNTVILMTANLGSDLLMQLLDEQPEASESDLHELLRPVLRGHFQPALL
ARFQTVIYRPLPAGALRAIVGMKLGQVSQRLACHYGITTTLSESLFDALTEACLLPDTGTRNVDSLLNQQ
ILPALSQQLLSHMAAGQKPRQVTLGYHEEEGVVMAFDEGAIADE
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|529985600|ref|NC_021232.1|:2481773-2484427 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGGAAAATCCAGCCAGCCTGTTACGCCGTCTTAATCCCTGCTGTGCCCGCGCAATGGAGGGGGCGGCCT
CCCTGTGCCAGACCCGGGCGCATGCCGAGATCCTGCCCGAGCACTGGCTGCTCAAGCTGCTGGAACAGGG
GGAAGGCGATCTGACGGTGCTGGCGCGGCGCTATGAATGGGATATGGATGCGCTGTGGCAGGATCTGCTG
AGCTGGCTGGATAAACAGCCGCGCTCGGTACGTCATCGTCCCCAGCTCTCTGACCATACCCTGCGGCTGA
TGCAGGAGGCCTGGCTGATTGCCTCGCTCAGCGGCGAAGCGCAGATCCGCAGTGTTCACCTGCTGATGGC
GCTGGTTGAAAAACAGAATCTGATCCAGTGCGATGGCCTGTGGCCGCTGTTAACGCTGGGCCAGCGTCAG
CTGGAACGCCTGCGCCCCTTGCTTGATGCCCAGTCCGACGAACGTCCGCCAGCGCAGCAGGAAGCTGCGC
TGGCGCAGCCCCATGGCGGGGACGTGGAATTTGTGGGGCGTCCTGCGGGCAGCGAACTGAATGCGGATGG
GCTCAATCCGGCGCTGCAGAACGCGCTGGACAAATTCACTCTCGACGTCACCGCCAAAGCCAGAGACGGC
CTGATTGACCCTGTGTTCGGACGTGACACGGAAATCCGCCAGATGGTGGATATTCTCTCCCGTCGGCGAA
AAAACAACCCAATCCTCGTCGGTGAGCCGGGCGTGGGCAAGACCGCTCTGGTGGAAGGCCTGGCGCTGCG
CATTGCCGAAGGCAACGTCCCCGACGCGCTGAAGCCAGTGTCGGTGCGCACCCTTGACCTCGGTCTGCTG
CAGGCCGGCGCCGGGGTCAAAGGCGAGTTCGAGCAGCGGCTGAAAAATATCATTGAGGCGGTACAGCAGT
CGCCTTCGCCGGTGCTGCTGTTTATCGACGAGGCGCACACGATCATCGGCGCGGGTAATCAGGCGGGCGG
CGCGGATGCCGCCAACCTGCTGAAGCCGGCGCTGGCCCGGGGCGAACTGCGGACTATCGCCGCCACCACC
TGGAGTGAATACAAGCAGTACTTCGAGCGCGACGCCGCGCTGGAGCGCCGCTTTCAGATGGTCAAGGTGG
ATGAGCCGGACGACGACACCGCCTGCCTGATGCTGCGCGGCCTGAAGTCCCGCTATGCCGACCACCACGG
CGTGCATATCACGGATGATGCGGTGCGCGCCGCCGTGACGCTGTCACGACGCTATCTCACCGGTCGCCAG
CTGCCGGACAAGGCAGTGGATTTACTCGACACCGCTTCCGCCCGCCTGCGTATGAGTTTGGATACCGTGC
CTGAGCCGCTGACCCGCATGAAGGCGCAGCTCACCGCGCTGGCAATGGAGAAGCAGGCGCTGCTGGAAGA
TATTGCGCTGGGCAACAGCGCCCGCGGCGATCGGCTGGCGGCCATTGAGCAGGAGGAGATCCGCCTTATT
CTGGCGCTGGATACCCTTGAAACTCAGTATGGTCAGGAGCTGCAGCTGACGGAAGCGCTGCTCGCCTGTC
GCCGCGATATCTCCCGCCAGGCGGAAATTAGCGATCTACAAACCGCGCTTATCGCCGTCCAGCAGGGCAA
TCCGCTGCTCGGGCTGGACGTCGACGTCCGCACCGTGGCGACGGTGATTGCCGACTGGACCGGCGTGCCG
CTCTCCTCGCTAATGAAAGATGAGCAGACGGAGCTGCTGAGTCTGGAAGAGAGTCTCGGCAAACGGGTGG
TTGGCCAGCAGGCGGCCCTGAGCGCTATTGCCCGGCGCCTGCGCGCCGCGAAAACCGGCCTGACGCCGGA
GAACGGTCCGCAAGGGGTGTTCCTGCTGGTCGGGCCGAGCGGCACCGGCAAAACGGAAACGGCGCTCGCC
CTGGCCGATGCGCTGTTCGGCGGCGAGAAAGCGCTGATCACCATCAATCTCTCCGAGTACCAGGAGCCGC
ACACCGTCAGCCAGCTGAAGGGTTCTCCGCCCGGCTACGTCGGCTACGGCCAGGGCGGGATCCTGACCGA
GGCGGTGCGCAAACGCCCCTACAGCGTGGTGCTGCTCGATGAGGTGGAAAAGGCCCATCGCGATGTGATG
AACCTGTTCTACCAGGTCTTCGACCGGGGGGTAATGCGCGACGGCGAGGGGCGTGAAATCGACTTTCGCA
ACACAGTGATCCTGATGACCGCCAACCTCGGAAGCGACCTCCTGATGCAGCTGCTGGATGAACAGCCGGA
GGCCAGCGAATCAGACCTGCACGAGCTGCTGCGCCCGGTGCTGCGCGGCCACTTCCAGCCGGCGCTGCTG
GCCCGCTTCCAGACGGTGATTTACCGTCCGCTGCCGGCGGGAGCGCTGCGCGCCATTGTCGGCATGAAGC
TCGGGCAGGTAAGTCAGCGTCTGGCTTGCCATTACGGAATCACCACCACCCTCAGCGAGAGCCTGTTCGA
CGCGCTGACCGAGGCCTGCCTGCTGCCGGATACCGGCACCCGCAACGTCGACAGTCTGCTGAATCAGCAG
ATCCTGCCGGCGCTGAGTCAGCAGCTATTGAGCCATATGGCGGCGGGGCAGAAACCGCGCCAGGTGACGC
TGGGGTATCACGAAGAGGAAGGCGTCGTGATGGCGTTTGACGAGGGGGCAATCGCCGATGAGTAG