SecReT6
Protein ID: 529987978
SecReT6 ID805
T6SS typei2
Gene symbol-
Locus tagKPR_2385
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]2484399..2486798 [+]
Producthypothetical protein
NoteTssI
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-64, Aligned region: 41..362
DUF2345 [PF10106], Evalue: 6.60E-39, Aligned region: 620..767
T6SS_Vgr [PF13296], Evalue: 1.30E-35, Aligned region: 496..600
T6SS_Vgr [PF13296], Evalue: 1.30E-35, Aligned region: 641..683
Phage_base_V [PF04717], Evalue: 2.10E-16, Aligned region: 346..365
Phage_base_V [PF04717], Evalue: 2.10E-16, Aligned region: 409..489
Sarcoglycan_1 [PF04790], Evalue: 0.0026, Aligned region: 656..731
Protein Sequence: 799 a.a.     [Download]
>gi|529987978|ref|YP_007991364.1| unnamed protein product [Klebsiella pneumoniae]
MTRGQSPMSSVKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAA
SLTLQAPVAQGFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNVIYQDQSVPQI
VEKILRERHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDS
QQGYEKGLTLPSVPPSGQQSAGVDAVWEMACCHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGE
AYHWGDNYLTAGNVHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCTTLCPGQVLKVTGGEEVAGEFA
DGVLVTAMHSHARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGSLPARVTSTRENDTYGHIDKHGRYR
VNMLFDRARWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVT
IRNDKRNVLRTPANNKIRLDDERGKEHIKLSTEYGGKSQLNLGHLVDSDRQPRGEGFELRTDSWGAIRAQ
KGILISADGQAQARGQVLDMEPAVSLLKGALNQITEWGRIAQIHHNFSPDADSLREFVNGASNLKEAALL
MVAPKGVASVTPDTALMHSGKGLYLQSLGEVNIATVQRHSVNASKAISLLSQQEGIRLVSAKGPLEVESH
ADTLSLTSLKDVTVQSTQGHLQLTAKNGITIACGGAYIQLTPEGEIKVHGPGLLSLKGQHNMEGPASQDF
PLPELPSSVCKDCLKRAQEIAQGFVPREV
 
Nucleotide Sequence: 2400 bp     [Download]
>gi|529985600|ref|NC_021232.1|:2484399-2486798 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
TTGACGAGGGGGCAATCGCCGATGAGTAGCGTGAAATCGTTGTTGTTCAGCCACAACCACCACCTGCTTT
CGGTGAAGGGATGTGAAGCCGGGCTTGATGTGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTT
CCGTTACCGTATTGAATTCACCAGCGCAGACCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCTGCC
TCCCTGACGCTGCAGGCGCCGGTGGCTCAGGGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCC
AGGGCGTGGTGACGGGGTTTGAACGGCTCAGTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCA
GCCGCGCTTGGCGCTGCTTAATCGCTCGCACCAGAACGTCATTTACCAGGACCAGTCCGTTCCGCAGATT
GTGGAAAAAATCCTCCGCGAGCGCCACGGCCTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGT
ATCCGCGCCGCGAGCAGGTGATGCAGTACGGCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGTGA
GGTGGGGATCTGGTTTCGCTTTACCGCCGACACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGT
CAGCAGGGCTATGAGAAGGGGCTGACGTTGCCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGG
ACGCGGTGTGGGAGATGGCATGCTGCCACCGCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTA
CCGCGAGGCGACGGCGGACATGAACGCACAGGTGGATGTCACCCGCGGGGAGACCACCACCTTTGGTGAG
GCTTACCACTGGGGAGATAACTACCTGACCGCCGGGAATGTCCATGACCGCCATCCGGCGCCGGAGTCCG
GGGCGTTTTACGCCCGGCTTCGTCATGAGCGTTATCTTAACGGCCAGACCCGGATGCAGGCCACCACCAG
CTGCACGACGCTCTGCCCGGGACAGGTGCTGAAGGTCACCGGTGGAGAGGAGGTGGCCGGGGAGTTTGCT
GATGGCGTGCTCGTCACGGCGATGCACAGCCACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCG
GCATACCGGACAGCCCGGACGTCGGCTACCGGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGTCGCT
GCCGGCCCGCGTGACCAGCACCCGGGAAAACGACACCTACGGGCATATCGACAAACACGGACGCTACCGG
GTGAATATGTTGTTTGATCGGGCGCGCTGGGAAACCGGGTTCGAGAGCCTGTGGGTCCGTCAGTCGCGGC
CGTATGCCGGAGACACTTACGGCCTGCACCTGCCGCTGCTGGCGGGGACGGAGGTGGCGATTGGCTTTGA
GGATGGTAACCCTGACCGGCCGTATATCGCGGGCGTCCTCCACGACTCGGCGCACGGCGACCACGTCACC
ATCCGCAATGACAAACGTAACGTCCTGCGCACCCCGGCCAACAACAAAATCCGCCTCGACGATGAGCGCG
GAAAAGAGCATATCAAGCTCTCGACGGAGTACGGCGGTAAGAGCCAGCTGAACCTGGGGCACCTGGTGGA
CAGTGACAGGCAGCCGCGTGGCGAAGGCTTTGAGCTGAGAACCGACAGCTGGGGCGCTATCCGGGCACAG
AAAGGGATACTCATCAGCGCGGACGGACAGGCGCAGGCCCGGGGGCAGGTGCTGGATATGGAGCCGGCGG
TCAGTTTGCTGAAAGGTGCGCTGAATCAGATAACCGAATGGGGCAGGATTGCCCAGATTCATCATAATTT
TTCACCAGACGCTGATTCACTGAGAGAGTTTGTTAACGGTGCCAGTAACCTGAAAGAAGCGGCTTTATTG
ATGGTTGCTCCCAAAGGGGTTGCTTCTGTTACCCCTGATACTGCGCTAATGCACAGTGGTAAAGGCCTCT
ACCTGCAAAGTCTGGGAGAGGTTAATATTGCAACCGTGCAGCGCCACTCAGTAAACGCCAGTAAAGCGAT
TTCGCTACTTTCACAACAGGAAGGGATCCGGCTGGTCTCGGCGAAAGGACCACTTGAAGTAGAATCACAC
GCAGACACACTCTCTCTTACGTCACTGAAAGACGTCACGGTTCAGTCAACACAAGGTCACCTGCAGCTAA
CGGCAAAAAACGGGATCACTATTGCATGTGGCGGCGCTTACATCCAGTTGACACCTGAGGGAGAAATTAA
GGTTCATGGCCCTGGACTGTTAAGCCTAAAAGGGCAGCACAACATGGAAGGACCTGCGAGCCAGGATTTC
CCGTTGCCTGAACTACCATCATCGGTCTGCAAAGATTGTCTGAAACGGGCACAGGAAATCGCTCAGGGTT
TTGTTCCAAGGGAGGTGTAA