SecReT6
Protein ID: 530320895
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p143
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]165235..167085 [-]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDS5YJ29
KEGG IDpami:JCM7686_pAMI6p143
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-51, Aligned region: 189..392
OmpA [PF00691], Evalue: 3.70E-14, Aligned region: 466..565
Protein Sequence: 616 a.a.     [Download]
>gi|530320895|ref|YP_008406855.1| type VI secretion system protein ImpK [Paracoccus aminophilus JCM 7686]
MAGRDEDRDKTVFGGPLTRGDVTSDSPFDSAGRGGAGRAGSGQIGGAPPPASDRTVIGRPAPGASAYPGS
GGFAPQGSGQPFGRPAPQGGGRGTGHEDTWIGAGAPQGYAAPPAQSPAPAYPSYPPPGQGASAPGHYAGI
GIGRPTAADNGFFPDYQRDRQPQVQRNVPRIPLQDALRVSEIGAGSSSNPLLAAAASLLILLGRLRTGMV
ELQVAPLMEHVTREIDRFERTAISAGLDPHEVLVAKYALSGTADDIVQNLPGSDRGSWQQYSMVARFFGK
RDSGVGFFQEAEKAMQAPAQRYNLLELMLVCMSLGFEGQFRTMPNGSVELTRIRTAIYETLRRVNPRPDE
DISVQWVPVVQDRGRRFGAVSVPIILGVAALAVVALFAGLTTLINRGGAQASEGLVTLHTGAPVLSIQRN
PGAVYVAEVPQLERIRTALANEIEAGMVSVEPKGDYIALRVGNLQLFDLGKTQVKEGFEPMAARITQILN
QEGGPVLIQGYTDNLPLSGRGQFKDNYQLSQARAKAVEAVLAKTIDDATRITVEGKGEEDPVADNTTEEG
RAQNRRVEVMLAREGTYTPKAGAAPAGAAPATATPAAPGAAPSGTPTTAPAQEAGQ
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c167085-165235 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGGCCGGGCGGGACGAGGATCGCGACAAGACGGTGTTCGGCGGTCCGCTGACGCGTGGCGATGTGACCT
CGGACAGCCCTTTCGACAGCGCGGGGCGGGGCGGTGCCGGTCGGGCCGGATCTGGTCAAATTGGTGGCGC
GCCGCCGCCTGCCTCTGATCGCACCGTCATCGGCAGGCCCGCGCCGGGCGCGAGCGCCTATCCCGGGAGC
GGCGGTTTCGCGCCGCAGGGCAGCGGCCAGCCCTTCGGGCGACCCGCGCCGCAGGGTGGCGGGCGCGGCA
CGGGGCATGAGGACACCTGGATCGGGGCGGGCGCGCCGCAGGGCTATGCCGCGCCGCCTGCGCAGAGCCC
GGCTCCCGCCTATCCGTCTTATCCGCCACCGGGTCAGGGTGCCTCGGCACCGGGCCATTATGCGGGCATT
GGCATTGGTCGCCCAACGGCGGCGGACAACGGCTTTTTCCCGGATTACCAGCGCGACCGCCAACCGCAGG
TCCAGCGCAATGTGCCGCGGATCCCGCTTCAGGACGCCTTGCGGGTCAGCGAGATCGGCGCGGGCAGTTC
CTCGAACCCGCTTCTGGCGGCGGCGGCGAGCCTGTTGATTCTGCTTGGCCGGTTGCGGACCGGCATGGTC
GAGCTGCAAGTCGCGCCGCTGATGGAGCATGTCACGCGCGAGATCGACCGCTTCGAGCGCACCGCGATCA
GCGCGGGTCTCGATCCCCATGAGGTGCTGGTCGCGAAATATGCGCTCTCGGGCACGGCCGATGACATCGT
CCAGAACCTGCCCGGCTCGGATCGCGGCAGCTGGCAGCAATATTCGATGGTCGCGCGCTTTTTCGGCAAA
CGCGATTCCGGCGTGGGCTTTTTTCAAGAGGCCGAAAAGGCGATGCAGGCCCCGGCGCAGCGTTACAATC
TGCTCGAGCTGATGCTGGTCTGCATGTCGCTGGGGTTCGAGGGCCAGTTCCGCACCATGCCGAACGGCTC
GGTCGAGCTCACCCGGATCCGAACCGCGATCTACGAGACCCTGCGCCGCGTCAATCCGCGCCCGGATGAG
GATATTTCCGTGCAATGGGTGCCGGTGGTGCAGGACCGCGGACGGCGCTTTGGCGCGGTCTCGGTGCCGA
TCATCCTTGGCGTGGCCGCTTTGGCGGTGGTTGCCCTCTTCGCCGGGCTGACGACCCTGATCAACCGGGG
CGGCGCGCAGGCCTCGGAAGGGTTGGTGACGCTGCACACCGGCGCGCCGGTTCTGTCGATCCAGCGCAAT
CCGGGCGCGGTCTATGTCGCCGAAGTCCCCCAGCTTGAACGCATCCGCACCGCTTTGGCCAATGAGATCG
AGGCGGGCATGGTCTCGGTCGAGCCCAAGGGCGATTACATCGCGCTGCGCGTTGGCAACCTTCAGCTCTT
CGATCTCGGCAAGACGCAGGTCAAAGAGGGCTTCGAGCCGATGGCGGCGCGGATCACCCAGATCCTGAAC
CAGGAAGGCGGCCCGGTGCTGATCCAGGGCTATACCGACAACCTGCCCTTGTCGGGACGCGGGCAGTTCA
AGGACAATTACCAGCTCTCGCAGGCGCGGGCCAAGGCGGTCGAGGCGGTTCTGGCGAAAACCATCGACGA
CGCCACCCGCATCACGGTCGAGGGCAAGGGCGAAGAGGATCCCGTGGCTGACAATACCACCGAAGAGGGC
CGCGCCCAGAACCGCCGCGTCGAGGTGATGCTGGCGCGCGAAGGCACCTATACGCCGAAGGCCGGTGCCG
CGCCTGCCGGTGCGGCTCCTGCGACAGCCACCCCGGCTGCGCCCGGCGCCGCCCCTTCCGGCACCCCGAC
AACCGCCCCCGCACAAGAGGCCGGACAGTGA