SecReT6
Protein ID: 530320896
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p144
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]167085..168419 [-]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDS5XVD1
KEGG IDpami:JCM7686_pAMI6p144
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.00E-118, Aligned region: 19..440
Protein Sequence: 444 a.a.     [Download]
>gi|530320896|ref|YP_008406856.1| type VI secretion system protein ImpJ [Paracoccus aminophilus JCM 7686]
MSWFSKVAWKEGLFLQPHHLQQSDRYVENLIQARNRVTTPYPWGVIEMVMDRDQAQQGRIALRAISGLMP
DGTPFDAPGTSPLPVPADVPDDAAGMFIWLTLPDVSPNNRDAAPYDDEGSATRWGIVAETVSDSSSALRS
EQVLELAVPRLELAVRKTPRPGYQNLRLARITEVRDGVVTIDETVPPPAMVVGAHPQILGYLTRVIGWVE
ARLETLARYAADPSSGGGLQASDFLMLMMLNREIGALRHLARTFAIHPERLYERLVCLAGELATFDSGNR
QAPDYEGYDHGDLKTCFSPIVSDIQRLLSRDIGRAIRLLLRQVRQNSYLAEVKDRNLFREATFIVEVESA
KPLTQVQQQFPELCKVGPNTRMSEIVNNNLPGIGLQHLPNPPRQIRVLSSNVYFRLEKNSPLWREFSTAP
AIGMHFAGDWPELKLELWAIPEKA
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c168419-167085 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGTCCTGGTTCAGCAAGGTCGCCTGGAAAGAGGGACTTTTCCTTCAGCCGCACCATCTCCAGCAATCCG
ACCGCTATGTCGAAAATCTGATTCAGGCGCGCAACCGTGTCACCACGCCCTATCCCTGGGGCGTGATCGA
GATGGTGATGGACCGCGATCAGGCGCAGCAGGGCCGGATTGCCTTGCGCGCGATTTCCGGGCTGATGCCC
GATGGCACGCCCTTCGATGCGCCGGGCACGAGCCCGCTGCCGGTGCCCGCAGATGTGCCCGATGATGCGG
CGGGAATGTTCATCTGGCTGACCTTGCCCGATGTCTCGCCCAACAACCGCGACGCCGCGCCCTATGACGA
TGAAGGCTCGGCGACGCGCTGGGGGATCGTGGCCGAGACGGTCAGCGATTCGAGCTCGGCCCTGCGCTCG
GAGCAGGTGCTTGAACTGGCCGTGCCACGCCTCGAGCTTGCGGTGCGCAAAACCCCGCGCCCCGGCTATC
AGAACCTGCGCCTTGCCCGGATCACCGAGGTCCGCGACGGCGTCGTCACCATCGACGAGACCGTGCCGCC
GCCCGCCATGGTCGTCGGCGCTCATCCGCAGATCCTTGGCTATCTGACCCGCGTGATCGGCTGGGTCGAG
GCGCGGTTGGAAACCTTGGCGCGCTATGCCGCCGATCCGTCCTCGGGCGGCGGGCTTCAGGCCTCGGACT
TTCTGATGCTGATGATGCTCAACCGCGAAATCGGCGCGCTGCGCCATCTCGCGCGGACCTTCGCCATCCA
TCCCGAGCGGCTTTACGAGCGGCTGGTCTGTCTGGCCGGAGAGCTTGCGACCTTTGACAGCGGCAACCGC
CAGGCCCCGGATTACGAGGGTTACGACCACGGCGATCTCAAGACCTGCTTCTCGCCGATCGTGTCCGACA
TCCAGCGGCTTTTGTCGCGCGACATCGGCCGCGCCATCCGGCTTTTGCTGCGTCAGGTGCGCCAGAACTC
CTATCTGGCCGAGGTCAAGGACCGCAATCTCTTCCGCGAGGCGACCTTCATCGTCGAGGTGGAATCCGCC
AAGCCGCTCACGCAGGTGCAGCAACAGTTCCCCGAGCTGTGCAAGGTCGGCCCGAACACCCGCATGTCCG
AGATCGTGAACAACAACCTGCCCGGCATCGGTTTGCAGCATCTGCCGAACCCGCCGCGTCAGATCCGGGT
GCTGTCCTCGAACGTCTATTTCCGGCTGGAAAAGAACTCTCCGCTCTGGCGCGAGTTTTCGACCGCGCCG
GCCATCGGCATGCATTTCGCCGGTGACTGGCCCGAGTTGAAGCTTGAGCTCTGGGCGATCCCGGAGAAAG
CCTGA