SecReT6
Protein ID: 530320906
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p154
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]182255..184999 [-]
Producttype VI secretion system ATPase
NoteTssH
UniProt IDS5XVE4
KEGG IDpami:JCM7686_pAMI6p154
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.60E-41, Aligned region: 228..252
AAA_2 [PF07724], Evalue: 6.60E-41, Aligned region: 609..775
AAA [PF00004], Evalue: 6.00E-21, Aligned region: 228..358
AAA [PF00004], Evalue: 6.00E-21, Aligned region: 615..699
ClpB_D2-small [PF10431], Evalue: 4.20E-15, Aligned region: 782..856
ClpB_D2-small [PF10431], Evalue: 4.20E-15, Aligned region: 861..878
AAA_16 [PF13191], Evalue: 5.60E-12, Aligned region: 206..249
AAA_16 [PF13191], Evalue: 5.60E-12, Aligned region: 272..307
AAA_16 [PF13191], Evalue: 5.60E-12, Aligned region: 441..530
AAA_16 [PF13191], Evalue: 5.60E-12, Aligned region: 584..653
AAA_16 [PF13191], Evalue: 5.60E-12, Aligned region: 680..700
AAA_5 [PF07728], Evalue: 7.20E-12, Aligned region: 228..250
AAA_5 [PF07728], Evalue: 7.20E-12, Aligned region: 614..741
AAA_22 [PF13401], Evalue: 2.70E-08, Aligned region: 227..308
AAA_22 [PF13401], Evalue: 2.70E-08, Aligned region: 501..572
AAA_22 [PF13401], Evalue: 2.70E-08, Aligned region: 612..651
AAA_19 [PF13245], Evalue: 1.90E-06, Aligned region: 228..252
AAA_19 [PF13245], Evalue: 1.90E-06, Aligned region: 612..636
AAA_14 [PF13173], Evalue: 2.90E-06, Aligned region: 228..307
AAA_14 [PF13173], Evalue: 2.90E-06, Aligned region: 613..697
Sigma54_activat [PF00158], Evalue: 3.20E-06, Aligned region: 222..243
Sigma54_activat [PF00158], Evalue: 3.20E-06, Aligned region: 614..728
AAA_17 [PF13207], Evalue: 6.90E-06, Aligned region: 228..270
AAA_17 [PF13207], Evalue: 6.90E-06, Aligned region: 469..515
AAA_17 [PF13207], Evalue: 6.90E-06, Aligned region: 614..649
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 228..256
NACHT [PF05729], Evalue: 1.20E-05, Aligned region: 615..648
Zeta_toxin [PF06414], Evalue: 1.70E-05, Aligned region: 227..250
Zeta_toxin [PF06414], Evalue: 1.70E-05, Aligned region: 613..664
IstB_IS21 [PF01695], Evalue: 2.60E-05, Aligned region: 211..247
IstB_IS21 [PF01695], Evalue: 2.60E-05, Aligned region: 614..645
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 208..249
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 279..311
Arch_ATPase [PF01637], Evalue: 0.00016, Aligned region: 613..649
AAA_18 [PF13238], Evalue: 0.00019, Aligned region: 228..251
AAA_18 [PF13238], Evalue: 0.00019, Aligned region: 616..642
NTPase_1 [PF03266], Evalue: 0.00066, Aligned region: 228..253
NTPase_1 [PF03266], Evalue: 0.00066, Aligned region: 280..304
NTPase_1 [PF03266], Evalue: 0.00066, Aligned region: 614..637
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 225..252
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 280..320
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 464..533
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 612..638
AAA_29 [PF13555], Evalue: 0.0032, Aligned region: 220..244
AAA_29 [PF13555], Evalue: 0.0032, Aligned region: 612..638
UPF0079 [PF02367], Evalue: 0.0039, Aligned region: 228..249
UPF0079 [PF02367], Evalue: 0.0039, Aligned region: 609..642
PRK [PF00485], Evalue: 0.0048, Aligned region: 229..275
PRK [PF00485], Evalue: 0.0048, Aligned region: 521..550
PRK [PF00485], Evalue: 0.0048, Aligned region: 615..640
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 229..249
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 615..636
Protein Sequence: 914 a.a.     [Download]
>gi|530320906|ref|YP_008406866.1| type VI secretion system ATPase [Paracoccus aminophilus JCM 7686]
MTAISIEKFAGKMNRLGYDAFLQAMRHARGEGNRNVELCHWLFYALSDQDCDISVTLRELKLDRGRVLKD
LDRAMAGLKKNVTEVPGIADSLADGLNHAWTYATLFFGETQIRTGHLLVSLLNDGGLRRELVMYSPVFAE
ISVDQLGKEARQLWSGSVEEELRPMDGSGLTAAGTGTRPDSATTALGRFSVDMTADAAAGKMDPVHGRDD
EIRQIIDVLMRRRQNNPILTGEAGVGKTAVVEGFAQRLASGEVPPALQGMRLHMLDIGAMQAGASMKGEF
EQRLRSVIDEVQSSPTPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTIGATTWAEYRNYFEK
DPALTRRFQPVQVDEPGIEQACYMIRGILGPMEAHHKVRISDEAVIAAVKLSARYIPARQLPDKAVSLLD
TACARVAVSQSSTPARIADLRDAINALDTEIAAKVAAEDLGERADDRLAEARADRDAKALELTAIEAKFE
EEKAVVDAIVDLRKRLAEEAGEDFDADAVRAEMTAKMADLAATHPDERMVYAHVDEQAVASVISDWTGIP
AGRMVADELQAILGLADHLKERVIGQDHGLQMIAKRVETSRAGLGNPNKPIGVFMLAGPSGVGKTETALA
LAEQLYGGEQNVITINMSEFQEAHSVSLLKGAPPGYVGYGEGGRLTEAVRRKPYSVVLLDEIEKAHPDVH
ELFFQVFDKGMMEDGNGRAINFRNTLILLTSNVGTEVIMRMAEGGETTPDLEVLDTRMKPELLKVFPPAL
LGRIVTIPYFPLSREVLGGITRLKLGAIVKRMRDAHGARLSYSDAVLDYIVEQCRDPDSGGRMVDNIITN
SILPDLSRQVLARMVEGGAMEDVRIELKDGGYDYVFGAARPAVAEAAPEAGAEKPARKKRAKKAEVDADL
EAEL
 
Nucleotide Sequence: 2745 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c184999-182255 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGACCGCGATCAGCATCGAGAAATTTGCCGGCAAGATGAACCGGCTGGGCTATGACGCCTTTCTGCAGG
CGATGCGCCATGCGCGCGGCGAGGGCAACCGCAATGTCGAGCTGTGTCATTGGCTGTTTTATGCGCTCTC
CGATCAGGATTGCGACATCTCGGTCACCCTGCGCGAGCTGAAGCTGGATCGGGGCCGCGTGCTCAAGGAT
CTCGATCGCGCCATGGCCGGGCTCAAGAAGAACGTGACCGAGGTGCCGGGCATTGCCGATAGTCTGGCCG
ACGGGCTCAACCACGCCTGGACCTATGCCACGCTCTTTTTCGGCGAGACCCAGATCCGCACCGGCCATCT
GCTGGTGTCCTTGCTCAACGACGGCGGGCTGCGGCGCGAGCTGGTGATGTATTCCCCGGTTTTCGCCGAG
ATTTCGGTCGATCAGCTGGGCAAAGAGGCACGCCAGCTCTGGTCCGGCTCGGTCGAGGAAGAGCTGCGGC
CGATGGATGGCTCGGGGCTGACGGCGGCGGGCACCGGCACGCGGCCCGACAGCGCGACGACGGCGCTTGG
CCGCTTCTCGGTCGATATGACGGCGGATGCGGCGGCGGGCAAGATGGACCCGGTGCATGGCCGTGACGAC
GAGATCCGCCAGATCATCGACGTGCTGATGCGCCGCCGCCAGAACAACCCGATCCTGACGGGCGAGGCCG
GTGTCGGCAAGACCGCCGTGGTCGAAGGTTTCGCGCAGCGTCTGGCCTCGGGCGAGGTGCCGCCCGCGCT
GCAAGGGATGCGGCTTCATATGCTCGACATCGGCGCGATGCAGGCGGGCGCGAGCATGAAGGGCGAATTC
GAGCAGCGCCTGCGCTCGGTTATCGACGAGGTGCAAAGCTCGCCGACCCCGATCATTCTTTTCATCGACG
AGGCTCATACGCTGGTGGGTGCGGGCGGCGCGGCCGGGACGGGCGATGCGGCGAACCTTCTCAAACCGGC
GCTGGCGCGCGGGACGTTGCGCACCATCGGCGCGACGACCTGGGCCGAATATCGCAATTATTTCGAGAAA
GACCCGGCGCTGACCCGCCGTTTCCAGCCGGTTCAGGTCGACGAGCCGGGGATCGAGCAGGCCTGTTACA
TGATCCGCGGCATCCTTGGCCCGATGGAGGCCCATCACAAGGTTCGCATTTCCGACGAGGCGGTGATTGC
GGCGGTGAAGCTGTCGGCGCGCTATATCCCGGCGCGGCAACTGCCTGACAAGGCGGTCTCGCTGCTGGAT
ACCGCCTGCGCGCGGGTCGCGGTCAGCCAATCCTCGACGCCCGCGCGCATCGCCGATCTGCGCGATGCGA
TCAATGCGCTGGACACGGAAATCGCCGCCAAGGTCGCTGCCGAGGATCTGGGCGAGCGTGCCGATGACCG
TCTGGCCGAGGCACGCGCGGATCGCGACGCCAAGGCGCTGGAACTCACCGCAATCGAGGCGAAATTCGAG
GAGGAAAAGGCGGTGGTCGATGCCATCGTCGATCTGCGCAAACGCCTTGCCGAAGAGGCGGGTGAGGATT
TCGACGCCGATGCCGTGCGTGCCGAAATGACCGCGAAAATGGCCGATCTCGCCGCGACCCATCCCGATGA
GCGCATGGTTTACGCCCATGTCGATGAACAGGCGGTGGCCAGCGTCATCAGCGATTGGACCGGCATTCCC
GCAGGCCGCATGGTCGCCGATGAATTGCAGGCGATCCTCGGTCTGGCCGATCATCTGAAAGAGCGAGTCA
TCGGGCAGGATCACGGGCTGCAGATGATCGCGAAACGGGTCGAGACCAGCCGCGCCGGTCTGGGCAACCC
GAACAAGCCGATCGGGGTTTTCATGCTCGCCGGTCCCTCGGGCGTCGGTAAGACCGAGACTGCGCTCGCG
CTCGCCGAACAGCTTTATGGCGGCGAGCAGAATGTGATCACAATCAACATGTCCGAATTCCAAGAGGCCC
ATTCGGTCAGCCTGCTGAAAGGCGCGCCGCCCGGCTATGTCGGCTATGGCGAGGGCGGGCGTCTGACCGA
GGCGGTGCGGCGCAAACCCTATTCGGTCGTGCTGCTCGACGAGATCGAAAAGGCCCATCCCGATGTCCAT
GAGCTCTTCTTTCAGGTCTTCGACAAGGGCATGATGGAGGACGGCAACGGACGTGCCATCAACTTCCGCA
ACACCTTGATCTTGCTGACCTCCAACGTCGGCACCGAGGTCATCATGCGCATGGCCGAGGGTGGCGAAAC
GACGCCCGATCTCGAGGTTTTGGATACGCGGATGAAGCCGGAACTGCTCAAGGTCTTCCCGCCCGCGCTT
TTGGGCCGGATCGTCACCATTCCCTATTTCCCGCTGAGCCGCGAGGTTCTGGGCGGGATCACCCGGCTCA
AGCTCGGCGCGATCGTCAAGCGGATGCGCGATGCCCATGGCGCGCGGCTGTCCTATAGCGACGCGGTCTT
GGATTACATCGTCGAGCAATGCCGCGATCCCGACAGCGGCGGGCGGATGGTTGATAACATCATCACCAAT
TCGATCCTGCCCGATCTCTCGCGGCAAGTGCTGGCGCGGATGGTCGAAGGCGGCGCGATGGAGGATGTTC
GCATCGAGCTGAAGGACGGCGGCTATGACTATGTCTTCGGCGCCGCTCGTCCCGCCGTTGCCGAAGCTGC
GCCTGAGGCTGGGGCGGAGAAGCCCGCCCGCAAGAAGCGCGCGAAAAAGGCCGAAGTGGACGCCGATCTC
GAGGCCGAGCTTTAA