SecReT6
Protein ID: 530320907
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p155
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]185022..186026 [-]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDS5Y7K2
KEGG IDpami:JCM7686_pAMI6p155
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-89, Aligned region: 6..298
Protein Sequence: 334 a.a.     [Download]
>gi|530320907|ref|YP_008406867.1| type VI secretion system protein ImpH [Paracoccus aminophilus JCM 7686]
MIASDAGFLALLRRFERTNPEQPPIGRSRRIAEEAVRLGQDPELAFPTAEFSETEKTRKGVPDLRVQFMG
FFGQNGALPLNTTEEAYRWTLDGEEAFVRFTDIFATRFYQLFFRAWSDSHAITQFDHPEGDRFADYVAAL
SGIGTPAFLDHDRFPDLARLPLVSIFGGRVRSPVRLQQMLIRYFGLEVDVEEHVPSWMEFDPEDFSRLGE
NGALGRSTYLGAKVRSVGEKIRLHVRARTLAEYRAFLPGAESYGQMANLVFWYLGKGYDVEVALSLPESE
IPPARLGQNADLGWMAALPRKPKAKKKKTAAKADEFVEASRFALALDSGLKRAA
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c186026-185022 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGATCGCGAGCGATGCCGGTTTCCTTGCGCTGCTGCGCCGTTTCGAGCGCACCAATCCCGAGCAGCCGC
CAATCGGGCGCTCGCGCCGGATCGCCGAAGAGGCCGTGCGTCTGGGGCAAGATCCAGAGCTGGCCTTCCC
GACCGCCGAATTCTCCGAGACCGAGAAGACCCGCAAGGGCGTCCCGGATCTGCGCGTGCAGTTCATGGGG
TTTTTCGGCCAGAACGGCGCTCTGCCGCTCAACACGACCGAAGAGGCCTATCGCTGGACGCTGGACGGCG
AAGAGGCCTTCGTGCGCTTCACCGACATCTTCGCGACCCGGTTTTATCAGCTCTTCTTCCGGGCTTGGTC
CGACAGCCATGCGATCACCCAATTCGACCATCCCGAAGGCGACCGCTTCGCCGATTATGTCGCGGCTTTG
TCGGGGATCGGCACGCCCGCCTTTCTCGACCATGACCGCTTCCCGGATCTGGCGCGGCTGCCGCTGGTGT
CGATTTTTGGCGGCCGGGTGCGCAGCCCGGTGCGCCTCCAGCAGATGCTCATCCGCTACTTCGGGCTTGA
GGTTGATGTCGAGGAACATGTGCCCTCGTGGATGGAGTTCGACCCCGAGGATTTCAGCCGTCTGGGCGAG
AATGGCGCGCTTGGGCGTTCGACCTATCTCGGCGCGAAAGTGCGCTCGGTTGGCGAAAAGATCCGGCTGC
ATGTCCGGGCGCGCACCTTGGCGGAATATCGCGCCTTCCTGCCCGGCGCCGAAAGCTACGGCCAGATGGC
GAACCTCGTCTTTTGGTATCTCGGCAAGGGCTATGATGTCGAAGTCGCCCTGAGCCTGCCGGAATCCGAG
ATCCCGCCCGCGCGGCTTGGGCAGAATGCCGATCTGGGCTGGATGGCGGCTTTGCCGCGCAAGCCCAAGG
CGAAGAAGAAAAAGACAGCGGCCAAGGCCGATGAATTTGTCGAGGCCTCGCGCTTTGCGCTGGCGCTCGA
CAGCGGATTGAAACGGGCCGCCTGA