SecReT6
Protein ID: 530320908
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p156
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]186023..187933 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDS5Z257
KEGG IDpami:JCM7686_pAMI6p156
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-166, Aligned region: 5..636
Protein Sequence: 636 a.a.     [Download]
>gi|530320908|ref|YP_008406868.1| type VI secretion system protein ImpG [Paracoccus aminophilus JCM 7686]
MRKAFRDAYNRELALLYERSSEFAAEYPGLADRLGGLLRENTDPWIAGLLEGTAFMAARVQLKLDEEFLG
FTQELLDQIFPEALAPIPSVMLIQARVAADRRDLEEGLHFAPGEYMDARFRDADQRVSCQFSLCAPLEIW
PLELTGAAYHDRPAVLGSLGQDPLEKTRAGLQIDLRHQTGSGLADLKLDDLTVHLTGSMPHAVALYEQIH
CDCLRISLRYLSAQGDPVFVRIPTETLSQIGFNRDENLFQRDDRLFSGFSLLRDQFVFPRKFLGFKLSGL
QKILRRIRASEAQLIIEFGRADDELAKHVDGTHLRLFCAPAVNLFEESSNQVRLDDRRFEYVVTPDSSPL
THYEVQRILKVYASYGTARTRVELHPLYSLPPGQVAQRNVMFYTSRRRPRRLTEGERQTGLRHDYRGTET
YITIYEPPEVEPGARAQRLHIKTLCSNRHLPAYLPIAGSDDFRMTNDVGVSLDCVAGPTRPREPMTEIDR
EGPHRLTQGEVHWRLISYLGLNHFGLDDRGDGDSASALRELVSLFADLSDNSIETQIAGIKELTTRPVVR
SIRREDGYFPARGLEISVTYDEAAFEGSGIIVLAAVLDRFFAEYANVNSFTQSVTISQQRGVIKRWPPRN
GKGPLL
 
Nucleotide Sequence: 1911 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c187933-186023 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGAGAAAGGCCTTTCGCGACGCCTATAACCGAGAGCTCGCGCTGCTTTATGAACGCTCGTCGGAATTTG
CGGCGGAATATCCGGGCCTTGCCGACCGGCTTGGCGGGCTTTTGCGCGAAAACACCGACCCCTGGATTGC
CGGTCTTTTGGAAGGCACCGCCTTTATGGCGGCGCGGGTTCAGCTGAAACTCGATGAAGAGTTTCTCGGC
TTCACGCAAGAGCTTCTCGATCAGATTTTCCCCGAGGCGCTTGCACCCATTCCCAGCGTCATGCTGATTC
AAGCGCGCGTCGCTGCGGATCGCCGCGATCTGGAAGAGGGCCTGCATTTCGCGCCCGGCGAATATATGGA
TGCGCGGTTTCGCGATGCCGATCAGCGCGTCTCCTGCCAATTCAGCCTGTGCGCGCCGCTAGAAATCTGG
CCGCTCGAATTAACCGGCGCGGCCTATCATGACCGCCCGGCGGTGCTGGGCAGTCTGGGGCAAGACCCGC
TGGAAAAGACCCGCGCGGGGTTGCAGATCGACCTGCGCCATCAGACTGGCTCGGGTTTGGCGGATCTCAA
GCTCGACGATCTGACCGTGCATCTGACCGGCTCGATGCCTCATGCGGTCGCGCTTTACGAGCAGATCCAC
TGCGATTGTCTGCGGATTTCGCTGCGCTATCTCTCGGCGCAGGGCGATCCGGTCTTTGTGCGCATTCCGA
CCGAGACGCTCAGCCAGATCGGTTTCAATCGCGATGAGAACCTCTTTCAACGCGATGACCGGCTCTTCAG
CGGCTTTTCCCTGCTGCGCGATCAATTCGTCTTTCCGCGCAAGTTTCTGGGCTTCAAGCTTAGCGGGTTG
CAGAAGATCTTACGCCGCATCCGCGCCAGCGAAGCGCAGCTGATCATCGAATTCGGTCGGGCCGATGACG
AGCTCGCCAAACATGTCGACGGCACGCATCTGCGGCTCTTCTGCGCGCCTGCGGTCAATCTTTTCGAGGA
AAGCTCGAACCAGGTCCGGCTCGATGATCGCCGCTTTGAATATGTGGTGACGCCGGACAGCTCGCCGCTG
ACCCATTACGAGGTCCAGCGCATTCTCAAGGTCTATGCGAGCTATGGCACCGCGCGCACGCGGGTCGAGC
TGCATCCGCTTTACAGCCTGCCGCCGGGGCAGGTCGCGCAGCGCAATGTCATGTTCTACACCAGCCGCCG
CCGTCCGCGTCGTCTGACCGAGGGCGAGCGCCAGACCGGGTTGCGCCATGATTATCGCGGCACGGAAACC
TATATCACCATCTACGAGCCGCCCGAGGTCGAGCCCGGCGCGCGGGCGCAGCGTCTGCATATCAAGACGC
TGTGCTCGAACCGCCATTTGCCCGCCTATCTGCCGATTGCGGGCTCGGATGATTTCCGGATGACGAATGA
CGTCGGCGTCTCGCTCGACTGCGTGGCAGGTCCGACTCGCCCGCGCGAGCCGATGACCGAGATCGACCGC
GAGGGGCCGCATCGCCTGACCCAGGGCGAGGTCCATTGGCGGCTGATCTCCTATCTCGGGCTGAACCATT
TCGGGCTTGATGATCGCGGCGATGGCGACAGCGCCTCGGCCCTGCGCGAGCTGGTGTCCTTGTTCGCCGA
TCTGTCCGACAACAGCATCGAGACCCAGATTGCCGGGATCAAGGAGCTGACGACGCGGCCGGTGGTGCGC
TCGATCCGGCGCGAGGACGGCTATTTCCCGGCGCGCGGGCTCGAGATTTCGGTGACCTATGACGAGGCCG
CCTTCGAGGGTTCGGGGATCATCGTGCTGGCGGCGGTGCTTGATCGCTTCTTTGCCGAATATGCCAATGT
GAACAGCTTCACCCAATCGGTGACGATCAGCCAGCAGCGCGGCGTCATCAAGCGCTGGCCGCCCCGCAAC
GGCAAGGGGCCGCTCTTATGA