SecReT6
Protein ID: 530320909
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p157
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]187930..188454 [-]
Producttype VI secretion system protein ImpF
NoteTssE
UniProt IDS5Y204
KEGG IDpami:JCM7686_pAMI6p157
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.10E-17, Aligned region: 43..148
Protein Sequence: 174 a.a.     [Download]
>gi|530320909|ref|YP_008406869.1| type VI secretion system protein ImpF [Paracoccus aminophilus JCM 7686]
MSIMHVFRDAAEAKDSRDPGRHYHDGERDVTVRSQKRREGASDASLRRDLARDVASLMNTIRLDTVSDLT
DAPYVQESIVNFGFQDLEGIWKSNSTMRDIASAIRTALIRNEPRLRSETLDVRVREEDPSPDQRVTFEIS
GEMISSPSDIAMEFLAEVDPSLGKIQMKRMQGES
 
Nucleotide Sequence: 525 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c188454-187930 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGTCGATCATGCATGTCTTTCGCGATGCCGCCGAAGCCAAGGATTCCCGCGATCCCGGACGCCATTATC
ACGACGGTGAGCGCGATGTGACCGTGCGCAGCCAAAAGCGCCGCGAGGGGGCGTCGGATGCCTCCTTGCG
CCGAGATCTGGCCCGTGATGTTGCCAGTCTGATGAATACAATCCGGCTTGATACGGTCAGTGATCTGACC
GATGCGCCCTATGTGCAGGAATCCATTGTCAATTTCGGATTTCAGGATCTCGAGGGGATCTGGAAATCCA
ATTCGACGATGCGCGATATTGCCAGCGCGATCCGAACCGCTTTGATCCGCAATGAGCCAAGATTGCGCTC
CGAGACGCTGGACGTGCGGGTCCGCGAAGAAGATCCGAGCCCGGATCAACGCGTCACCTTTGAAATCTCC
GGAGAAATGATTTCAAGCCCGTCGGATATTGCGATGGAATTTCTTGCCGAAGTTGATCCATCCTTGGGCA
AGATCCAGATGAAAAGAATGCAGGGCGAGTCATGA