SecReT6
Protein ID: 530320910
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p158
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]188638..189135 [-]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDS5YJ47
KEGG IDpami:JCM7686_pAMI6p158
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-37, Aligned region: 6..138
Protein Sequence: 165 a.a.     [Download]
>gi|530320910|ref|YP_008406870.1| type VI secretion system effector, Hcp1 family [Paracoccus aminophilus JCM 7686]
MAVDYFLKLSNNIKGESQDEKYRDAIDVLGWNWGLTQSGTTHLGKGGGGGKVNVSDIHLTKYVDLATNDL
IKRCANGEHIETGELIVRKSGGTAPVEYMKIKLEQIMISSYSTGGQKDGLDRVQESLSLNFRRFEVTYSL
QDENGAAGAETSTGWEIAENREWSA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c189135-188638 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGGCTGTTGATTACTTTCTGAAACTCTCCAACAATATCAAAGGTGAGTCCCAGGACGAGAAGTATCGCG
ATGCGATCGACGTTCTGGGCTGGAACTGGGGTCTGACCCAATCCGGCACCACCCACCTTGGCAAAGGCGG
CGGTGGTGGCAAGGTCAACGTCTCGGATATTCATCTGACCAAATACGTTGATCTGGCAACCAATGACCTG
ATCAAGCGCTGCGCCAATGGCGAGCACATTGAAACCGGCGAACTGATTGTGCGGAAATCGGGCGGTACCG
CTCCGGTGGAATACATGAAGATCAAGCTGGAACAGATCATGATCTCGAGCTACAGCACCGGCGGCCAGAA
AGATGGCCTTGACCGCGTGCAGGAATCGCTCTCGCTGAACTTCCGCCGCTTCGAAGTCACCTACTCCCTG
CAGGACGAGAACGGGGCCGCTGGCGCCGAGACCTCGACCGGTTGGGAAATCGCCGAGAACCGCGAGTGGT
CTGCCTGA