SecReT6
Protein ID: 530320911
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p159
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]189171..190661 [-]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDS5XVF0
KEGG IDpami:JCM7686_pAMI6p159
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-171, Aligned region: 66..493
Protein Sequence: 496 a.a.     [Download]
>gi|530320911|ref|YP_008406871.1| type VI secretion system protein ImpC [Paracoccus aminophilus JCM 7686]
MAQEAQLQPGASQGLSELDEFSDILRQTIKPRSDVAAKEVDSAVVALVREALDDSTLIADDVIDTIDAML
SKLDQKLTEQLNAIMHHDEFQRLEASWRGLAYTINNSETDSSLRVKVMNVSKKELQQMMRRFPGAKWDKS
PLHQRVYEAEFGTLGGKPFGALIGDYFFDHSTPDVALLRDIGKIAAAAHAPFISSAAPELLGMDSWTEIG
VPPDLSEIFDTPDYAGWNSLRDSQNSRYIALTMPRVLSREPYGQNSNSVVEEFNYEEETDGRAGEKYAWM
NAVHAMAVNINRAHKEYGWTVQIRGVQSGGEVLNLPAHTFETGDGAKELKCPTEVSITDRREGELSKAGL
IGLIHRKHTDKAAFIGAQTLYRPKKYVDDLATASDNLSSRLPYIFAVSRFSHYLKCMVRDKIGQSPDRLQ
LQTQLQTWVNKYVSGNPESASEREKAKKPLAGAKVEVIEDEENPGYYMGKFYLKPHFQLEGMDVGMSLVS
KLPKGK
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c190661-189171 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGGCACAGGAAGCACAGCTCCAGCCTGGTGCCAGTCAGGGCCTGTCCGAACTGGACGAATTCTCTGACA
TTCTGCGCCAGACCATCAAGCCGCGCAGCGATGTCGCGGCGAAAGAGGTCGATAGTGCCGTTGTCGCGCT
GGTGCGCGAGGCCTTGGACGATTCCACGCTGATCGCCGATGATGTCATCGACACGATCGACGCGATGCTG
TCGAAGCTCGACCAGAAACTGACCGAGCAGCTCAACGCGATCATGCATCACGATGAGTTCCAACGGCTCG
AGGCCTCGTGGCGCGGGCTCGCCTATACGATCAACAACTCCGAGACCGATTCCAGCCTTCGCGTGAAGGT
GATGAACGTTTCGAAGAAAGAATTGCAGCAGATGATGCGCCGTTTCCCCGGCGCAAAATGGGACAAATCG
CCCCTGCATCAGCGCGTCTACGAGGCCGAGTTCGGCACGCTTGGCGGCAAGCCGTTCGGCGCTTTGATCG
GCGACTATTTCTTCGACCATTCGACCCCCGATGTAGCCTTGCTGCGCGATATCGGCAAGATCGCGGCCGC
GGCCCATGCGCCCTTCATCTCTTCGGCAGCGCCCGAGCTGCTGGGAATGGACAGCTGGACCGAAATCGGC
GTGCCGCCCGATCTGTCGGAGATCTTCGACACGCCCGATTATGCCGGTTGGAACAGCCTGCGCGATTCTC
AGAACTCGCGTTATATCGCGCTGACCATGCCGCGCGTTCTCTCGCGCGAACCCTATGGTCAGAATTCGAA
CTCGGTGGTTGAGGAATTCAACTACGAGGAAGAAACCGATGGGCGTGCGGGCGAGAAATACGCCTGGATG
AACGCGGTCCATGCCATGGCCGTTAACATCAACCGCGCGCATAAGGAATATGGCTGGACGGTGCAGATCC
GTGGCGTCCAGTCGGGCGGCGAGGTTTTGAACCTGCCCGCGCATACGTTCGAAACCGGCGACGGCGCGAA
AGAGCTGAAATGCCCGACCGAGGTTTCGATCACCGACCGGCGTGAAGGTGAATTGTCGAAAGCCGGTCTG
ATCGGCCTTATTCACCGCAAGCATACGGATAAAGCCGCCTTTATCGGCGCGCAAACCCTGTATCGCCCGA
AGAAATATGTCGATGATCTGGCAACCGCTTCGGACAATTTGTCCTCGCGCCTGCCTTATATCTTCGCAGT
GTCGCGTTTCAGCCATTATCTGAAGTGTATGGTGCGCGACAAGATCGGGCAAAGCCCGGACCGTCTGCAA
CTGCAAACCCAGCTGCAGACTTGGGTTAACAAATATGTTTCAGGCAATCCCGAAAGCGCAAGCGAGCGGG
AAAAGGCGAAAAAGCCTTTGGCCGGAGCTAAGGTGGAAGTGATCGAGGATGAGGAGAACCCCGGCTACTA
CATGGGGAAATTCTACCTCAAGCCGCACTTCCAGCTTGAAGGAATGGATGTCGGGATGTCTCTCGTCTCC
AAATTGCCGAAAGGCAAGTAA