SecReT6
Protein ID: 530320912
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p160
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]190661..191179 [-]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDS5Y7K7
KEGG IDpami:JCM7686_pAMI6p160
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-51, Aligned region: 10..164
Protein Sequence: 172 a.a.     [Download]
>gi|530320912|ref|YP_008406872.1| type VI secretion system protein ImpB [Paracoccus aminophilus JCM 7686]
MVSDKSTDFIKRNRPPRVNISYEDPYDSEKMVELPFVMGMMSDLSGNASQVEKKPMEERDFVDVTAATLD
EFIDSVRPGLAFNAENRLGDGEGRMGVSLEFSSMDDFNPANVARQVPALKKLLEAREHLANLQRYMNSKP
KAQEQIRQLLNDPDLMAALAERSKAEAKGEDE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c191179-190661 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGGTATCGGATAAATCAACGGACTTCATCAAACGAAACCGCCCGCCGCGGGTGAACATTTCGTATGAAG
ACCCGTATGACAGCGAAAAAATGGTCGAGCTTCCCTTTGTCATGGGGATGATGTCCGACCTGTCCGGCAA
TGCTTCGCAGGTCGAGAAAAAGCCGATGGAAGAACGCGATTTCGTCGACGTGACCGCGGCGACGCTGGAC
GAGTTCATCGACTCGGTTCGCCCGGGACTTGCCTTCAACGCCGAGAACCGTCTGGGCGATGGCGAGGGCC
GCATGGGCGTGTCGCTTGAGTTCAGCTCGATGGACGATTTCAACCCGGCCAATGTCGCGCGTCAGGTTCC
GGCGCTCAAGAAGCTTCTGGAAGCGCGCGAGCATCTGGCCAACCTGCAGCGTTACATGAACTCGAAGCCG
AAGGCGCAAGAGCAGATCCGTCAGCTCTTGAACGATCCCGACCTGATGGCGGCCTTGGCCGAACGCAGCA
AGGCCGAAGCCAAGGGTGAGGACGAATAA