SecReT6
Protein ID: 530320913
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p161
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]191254..192618 [-]
Producttype VI secretion system protein ImpA
NoteTssA
UniProt IDS5Z263
KEGG IDpami:JCM7686_pAMI6p161
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-06, Aligned region: 75..126
ImpA-rel_N [PF06812], Evalue: 1.80E-06, Aligned region: 204..222
Protein Sequence: 454 a.a.     [Download]
>gi|530320913|ref|YP_008406873.1| type VI secretion system protein ImpA [Paracoccus aminophilus JCM 7686]
MALDWLLDPVTEEAPCGPDLERSDDGEFLDYYFEAEGRLPERYFTPGAPNLLGGTEDLVFDPRSVQLKRE
VGAITALLQRSRDLRLLSLLARFQILAARPADFATTLEAMAELMAARLNEVHPQLDEGVSERRGALDALA
EQTTVVMPLVYLPLLSHADVSYRRYLVASGEVVPRGAEAESEATTADLISLLKNPSNAPALSQLFAELTR
AALALRRIAGLCMTNGHRAFTPDFTPALDTISDLQRLIREAVPGLTPWSETADAALPEVAAPIEAATAAP
EDSAPVAVVAPIPTAGAVQIANHAEARATIEAAETYLAAFEPSSLSLLLVTQARLLVGKSIVEAIELLRP
QQAELASFNLGSGLGFSLDMGRLRMLAQSVPGNQGDSPAAAETKPAAIRDRGELAASLRGVEDFYLRNEP
ASPVPVLLGGARTMLTKTFDAILSELLPSEAQQV
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c192618-191254 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGGCTTTGGACTGGCTTCTGGACCCCGTGACGGAAGAAGCGCCTTGCGGGCCCGATCTCGAACGGTCGG
ATGACGGCGAATTCCTCGACTATTACTTCGAAGCCGAGGGCCGTCTGCCCGAGCGCTATTTCACCCCCGG
CGCGCCGAATTTGCTGGGCGGCACCGAGGATCTCGTCTTTGATCCGCGCTCGGTCCAGCTCAAGCGCGAG
GTCGGTGCGATCACCGCGCTCTTGCAGCGCAGCCGCGATCTGCGGCTTCTGAGCCTGCTCGCGCGGTTCC
AGATCCTCGCCGCCCGCCCGGCGGATTTCGCGACCACGCTGGAGGCGATGGCCGAGCTGATGGCGGCGCG
GCTGAACGAGGTGCATCCGCAGCTTGACGAGGGCGTCTCGGAACGGCGCGGGGCGCTCGATGCTTTGGCC
GAGCAGACGACCGTGGTCATGCCGCTGGTCTATCTGCCGCTCTTGTCCCATGCCGATGTCAGCTATCGCC
GCTATCTGGTCGCCTCGGGCGAGGTCGTGCCGCGCGGGGCCGAGGCTGAAAGCGAGGCGACGACGGCGGA
TCTGATCTCGCTGTTGAAAAACCCTTCGAATGCGCCCGCGCTCAGCCAGCTCTTCGCCGAGCTGACCCGC
GCGGCTTTGGCGCTGCGCCGGATTGCGGGCCTGTGCATGACCAACGGGCACCGCGCCTTCACGCCGGATT
TCACGCCTGCGCTCGACACGATCTCCGATCTGCAACGGCTGATCCGCGAGGCTGTGCCCGGGCTGACCCC
CTGGAGCGAAACCGCCGATGCGGCCCTGCCCGAGGTGGCTGCTCCGATCGAGGCCGCCACCGCCGCCCCG
GAGGACAGCGCGCCGGTCGCTGTCGTCGCGCCGATCCCGACGGCGGGGGCGGTGCAGATTGCCAACCATG
CCGAGGCGCGCGCGACGATTGAAGCCGCCGAAACCTACCTCGCCGCCTTCGAGCCGTCGTCGCTGTCGCT
GCTGCTGGTGACGCAGGCGCGGCTCCTCGTCGGCAAGTCGATTGTCGAGGCGATCGAGCTTTTGCGTCCG
CAGCAGGCCGAGCTTGCCTCGTTCAATTTGGGCAGCGGTCTGGGCTTCTCGCTCGACATGGGGCGGCTGC
GGATGTTGGCGCAATCAGTGCCGGGGAATCAGGGTGATTCTCCTGCCGCTGCGGAAACTAAACCTGCGGC
AATTCGCGATCGCGGGGAACTCGCCGCAAGCTTGCGCGGGGTCGAAGACTTCTACCTGCGTAACGAACCT
GCGAGCCCCGTGCCGGTTCTACTGGGGGGTGCAAGGACCATGCTCACGAAAACCTTTGACGCGATTTTGA
GTGAGCTCTTGCCCTCGGAGGCCCAACAAGTCTAG