SecReT6
Protein ID: 530320914
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p162
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]192658..193977 [-]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDS5Y212
KEGG IDpami:JCM7686_pAMI6p162
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-11, Aligned region: 30..95
Protein Sequence: 439 a.a.     [Download]
>gi|530320914|ref|YP_008406874.1| type VI secretion system protein ImpI [Paracoccus aminophilus JCM 7686]
MSLTLLIENYQILDDGGPASMVVPEGGLQVGRREGMGWVLPDASRHISGHHFDVYRQGEEWWLRDASTNG
TFLHGMRHRLDGPHKLEHGDRFQVGQYVVVALMDAPSLQGGVNANSLPSYGGPVFAQETEADPWSMGGGL
DPVDPLPRQHHGGQGDFENEFMAFPRHDAAAAHPVAAAPVAAVHPAAPPAATVAQSSASPFESGSVDAGL
GGALAGGLVAPLAQAPAPAHAPVSPPQPAMAAADPGAGMLRAFCEGAGLPPDWGQGVPPEAFAYALGQTL
RAATSEVMLALRDRASAKQFVRVGERTMRGATDNNPLKFLPDPEQAMEAMFLRPRAGFMTGAAGFDEALR
DLRQHQAALFAALQPALMKLVGDLAPEDIEAGSETGRFGSNRKARAWETYVERWDAKAAPHENGMLDEFI
QHFAAAYRDALAQGRGRGR
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c193977-192658 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
ATGTCGCTCACGCTTCTCATAGAGAATTACCAGATCCTCGATGATGGCGGCCCGGCCAGCATGGTGGTGC
CCGAGGGCGGGCTGCAGGTTGGACGCCGCGAGGGCATGGGCTGGGTCCTGCCCGATGCGAGCCGCCATAT
CTCGGGCCATCACTTCGATGTCTACCGCCAGGGAGAGGAGTGGTGGCTGCGCGACGCCTCGACCAATGGC
ACTTTCCTGCATGGGATGCGTCATCGGCTGGATGGGCCGCATAAGCTGGAGCATGGCGACCGCTTTCAGG
TCGGCCAATATGTCGTCGTCGCGCTGATGGACGCGCCCTCGTTGCAGGGCGGCGTCAATGCCAATTCGCT
GCCGTCCTATGGCGGGCCGGTCTTTGCGCAAGAGACCGAGGCCGATCCTTGGTCGATGGGCGGCGGGCTT
GATCCGGTCGATCCCTTGCCGCGCCAGCATCATGGCGGGCAGGGCGATTTCGAAAACGAGTTCATGGCCT
TTCCGCGCCATGATGCCGCCGCCGCACATCCGGTTGCAGCCGCGCCGGTCGCAGCGGTTCATCCGGCCGC
CCCGCCTGCGGCCACTGTCGCCCAAAGCAGCGCCTCGCCTTTCGAGAGCGGCAGTGTGGACGCTGGTCTT
GGTGGCGCTTTGGCGGGCGGTCTGGTCGCACCGCTGGCCCAAGCCCCGGCACCGGCTCACGCGCCAGTCT
CGCCGCCGCAACCCGCCATGGCTGCCGCCGATCCGGGCGCGGGAATGCTGCGTGCCTTTTGCGAAGGCGC
GGGCCTGCCGCCCGATTGGGGGCAGGGCGTGCCGCCCGAGGCTTTTGCCTATGCGCTTGGTCAGACCCTG
CGCGCGGCGACCTCCGAGGTGATGCTGGCCCTGCGCGACCGCGCTTCGGCCAAGCAATTCGTGCGGGTCG
GCGAGCGCACGATGCGCGGCGCCACCGACAACAATCCGCTGAAATTCCTGCCCGACCCCGAGCAGGCGAT
GGAGGCGATGTTCCTGCGCCCGCGCGCGGGCTTCATGACCGGCGCGGCAGGCTTCGACGAGGCTTTGCGC
GATCTGCGCCAGCATCAGGCCGCGCTCTTCGCGGCCTTGCAACCGGCCCTGATGAAACTGGTCGGCGATC
TGGCGCCCGAAGACATCGAGGCCGGTTCCGAGACCGGGCGCTTCGGCTCGAACCGCAAGGCGCGCGCTTG
GGAGACCTATGTCGAGCGTTGGGATGCCAAGGCGGCCCCCCATGAGAATGGGATGCTCGACGAATTCATT
CAGCATTTTGCAGCGGCCTATCGCGATGCCTTGGCGCAGGGCCGGGGACGCGGCCGGTAG