SecReT6
Protein ID: 530331575
SecReT6 ID837
T6SS typei1
Gene symbol-
Locus tagI137_08675
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]1864637..1865293 [+]
Productmembrane protein
NoteTssL
UniProt IDS5VAD9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-58, Aligned region: 1..200
Protein Sequence: 218 a.a.     [Download]
>gi|530331575|ref|YP_008381205.3| membrane protein [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MIDAATPLLGMVMRVSGMNSHAMPEHLFTQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGN
GWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLMSEPKRYQDLLEFLYICFSLGFRGRAVQDQGEFEQI
YRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLIKRLTIRHVLCGGIVVLALFYLFYLLRLDSQTQDILH
QLNRLLAR
 
Nucleotide Sequence: 657 bp     [Download]
>gi|529218781|ref|NC_021984.1|:1864637-1865293 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGATCGATGCCGCCACCCCGCTGCTGGGGATGGTGATGCGCGTTTCGGGCATGAACAGCCATGCCATGC
CTGAACACCTGTTCACCCAGGTGGTGACGGATGTGCAGGCGGTGGAGCAGTTACTCCAGGAGCAGGGCTA
TGAGCCTGGGGTGATTATCTCGTTTCGTTACATCCTGTGTACCTTTATTGACGAGGCGGCGCTGGGGAAT
GGCTGGTCGAACAAAAACGAGTGGATCAAGCAGTCGCTGCTGGTGCATTTCCATAACGAAGCCTGGGGCG
GTGAAAAGGTTTTTATCCTGCTGGAGCGCCTGATGAGCGAACCCAAACGCTACCAGGATCTGCTGGAATT
TTTGTACATCTGCTTTTCGCTGGGCTTTCGCGGGCGCGCCGTCCAGGACCAGGGGGAGTTTGAGCAGATA
TACCGCCGCCTGTATCACGTCCTGCATAAGCTGCGCGGCGATGCGCCCTTTCCGCTGCTGCACCAGGATA
AAAAAACCCAGGGCGGGCGCTATCAGCTGATTAAACGGCTGACCATCCGGCATGTTCTGTGCGGCGGCAT
CGTCGTACTGGCGCTGTTTTATCTGTTTTATCTGCTGCGTCTGGACAGTCAGACGCAGGACATTCTTCAT
CAGTTAAACCGGCTGCTTGCCAGGTAA