SecReT6
Protein ID: 530629738
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2000
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2052004..2053371 [+]
Producthypothetical protein
NoteTssK
UniProt IDS5Z7B1
KEGG IDkpj:N559_2000
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-130, Aligned region: 27..452
Protein Sequence: 455 a.a.     [Download]
>gi|530629738|ref|YP_008425006.1| hypothetical protein N559_2000 [Klebsiella pneumoniae JM45]
MKAKGTGGAMKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNA
TRLIVRFADGTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTV
QELAGHERSELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELG
ELLHRLQARRRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHQDPSRHPELLYRELARLA
GSLLTFSLEHHLEAIPRYRHASPEQVFPPLFALLDTLLEVSLPSRVIAIVLEQGADREIWRGRLHDARLR
EGADFYLSVRSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDL
STDAARAMLEAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2052004-2053371 Klebsiella pneumoniae JM45, complete genome
ATGAAAGCGAAAGGCACAGGAGGTGCAATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGG
TCCCGCAGCAGTTTCAGCAACAGGCCCGCTGGGACGCGCACGTCGCCGATACGGTCTCCCGCATGGCGCT
CGCCCACCCGTGGGGGGTATTGCGCGCGGAGTTTGACGCGAGCGCGCTCACCCTTTCCCGGCTCAACGCT
ACCCGGCTGATCGTGCGTTTCGCCGACGGAACGCTGATTGACACCGAGCTGGCGGATATTTTGCCACCGG
TCCGCGATGTATCGGACGTGATGCAGGACAGCGTGGAGGTTCTGCTCGCTCTGCCGCTGCTCAGCGCCAG
CGGCGGCAATCTTGATGACGGCCAGGAGAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTC
CAGGAGCTGGCCGGCCATGAACGCAGCGAGCTGGCCGTTCTGCGGCACGCGCTAACGCTGCGTCTCTCCA
CCGAGGAAAATGCAGCCTTCCTCACCTGCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGAT
CGTTGACCCGGAATTCATCCCGCCGCTGCTGTCGCTGGCGGCAAGCCCGACGCTGGTTAGCGAGCTGGGT
GAGCTGTTACATCGCCTGCAGGCCCGACGCAGACGCCTGATGGCCATGCGTCGTGAAAGCAATGCGCGGA
TGGCTGATTTTGCCGTGGCGGATGTTTCCCTGTTCTGGCTGCTCAACGCGCTGAACAGCGCTGAACCGGT
GCTCAGCGAGCTGCATCAGGACCCTTCGCGCCATCCGGAGCTGCTCTATCGCGAACTGGCCAGGCTGGCC
GGCAGTCTGCTGACTTTCTCCCTTGAACATCATCTGGAAGCAATCCCCCGCTACCGACATGCCTCGCCAG
AGCAGGTATTCCCACCGCTGTTTGCCCTGCTGGATACGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGAT
CGCCATCGTTCTGGAGCAGGGCGCCGACCGGGAGATCTGGCGGGGCAGGCTGCACGATGCGCGGCTGCGC
GAGGGGGCGGATTTTTATCTGTCGGTGCGCTCTTCACTCCCCCCTCACCAGCTACAGAGCCGCTTTCCGC
AGCTCTGTAAGGCGGGTAGCCATGATGATGTCGCCGAGGTCGTCAATATTGCCCTCAGCGGCATCGCGAT
CAAACCGCTGAGCCATGTGCCGGCGGCCATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGATCTC
TCCACCGATGCCGCCCGCGCGATGCTGGAGGCCGGCAACTGCACCTTCTATACCCCGGAATCGCTTGGCG
ACGTGAAACTTGAACTCTTTGCGGTACTGCGCTCATGA