SecReT6
Protein ID: 530629739
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2001
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2053368..2054021 [+]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDS5YG47
KEGG IDkpj:N559_2001
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.60E-42, Aligned region: 10..205
Protein Sequence: 217 a.a.     [Download]
>gi|530629739|ref|YP_008425007.1| type VI secretion system protein ImpK [Klebsiella pneumoniae JM45]
MNTSESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFFRTLQLGFVGQY
RAEDDERREDVAQALGARVPPFSMTQEAPVVVRASRLRSGRRMYWCGWAAGIVALAALWLTFSSVLSQMV
AQIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2053368-2054021 Klebsiella pneumoniae JM45, complete genome
ATGAATACCTCTGAAAGCGATCTGATCAACAAAACCTTTTACCCGGGCTGGCTGATGGTCAGCCAGTTAC
GCTGCGGCCAGCCGGTGACCGATGGCGAGGCGCTCTATCGCCAGGCCTGTCGATGGGTGACCGAAGCGCG
CGAGGCGCTGACGGCGGGGGGAGTCAGTGAAGCCAGCGCTGAGCAGATGCTCTATGCCTACTGCGCGCTG
CTCGATGAGAGCGTCCTCAACCGCGCCAGTCAGGATGATGGCTACCGCAGGTGGCGCAAGGATCCGCTGC
AGGCGCGCTTTTTCAGCACTCTCAACGCCGGGGAAGAGCTCTGGGAACGGATCCGCCAGCTGCTGCGAGA
GCCCACGGCGGATGCGGCAGTGCTGACCTGCTTCTTTCGTACTTTACAGCTGGGATTTGTCGGACAGTAC
CGCGCCGAGGATGACGAACGGCGTGAGGACGTGGCGCAAGCGCTTGGCGCGCGGGTCCCGCCGTTCAGCA
TGACCCAGGAGGCGCCGGTGGTGGTTCGTGCCTCCCGGCTGCGCAGCGGACGGCGGATGTACTGGTGCGG
CTGGGCGGCTGGCATTGTGGCGCTGGCGGCGCTGTGGTTGACCTTCTCCTCCGTGCTGTCACAGATGGTG
GCGCAGATAGCAGGGCAGGGATAA