SecReT6
Protein ID: 530629740
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2002
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2054025..2055722 [+]
Producthypothetical protein
NoteTagL
UniProt IDS5YUQ7
KEGG IDkpj:N559_2002
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.30E-17, Aligned region: 435..531
Protein Sequence: 565 a.a.     [Download]
>gi|530629740|ref|YP_008425008.1| hypothetical protein N559_2002 [Klebsiella pneumoniae JM45]
MRDNARRLLTILTVILALWLVLGFWPLSIGNQVIFSLCILLAGGAALWRQRRRAVSRQRSEIVLPPEDFQ
GAVVLVCGDTDGLFPGRSAHGETRHGWYLRGDSAEQLPRLAQYLAAARPALVSQVSVLLAVVPEHHPSGE
HLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAAESRWFTITPERAGLQAQQKGQAPQAVAGWQ
REGSSASRLHQTLWLESILTLAENALFRPFRARQAELPPLNLCAAGICLTPVAAVANNLWQQQIAGITTL
SPGNDAAPGPHPLPDLLLSSLPHRHGVSRRMRDAGLAAGVGFLFLALAMLASFINNQRLVRSVGDHLAVY
HRLSGTPPTPKLQAQQRLRADSRLLDDWLRRGEPLRYRLGLYQGGRLIPFVEAAINDWAPPPPPRPVIKQ
VVQGPQTIRLDSMALFDTGKSTLKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDKSNQQLSLKRAE
AVRDWMRDTGDVPVSCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKDACLTPGTANTSGAETNGL
KSETE
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2054025-2055722 Klebsiella pneumoniae JM45, complete genome
ATGCGTGATAACGCCCGTCGTCTGCTTACGATACTGACCGTCATCCTGGCCCTGTGGCTGGTGCTGGGCT
TCTGGCCGCTGTCCATCGGCAACCAGGTGATCTTCAGTCTGTGCATCCTGCTGGCGGGCGGCGCGGCGCT
CTGGCGTCAGCGTCGCCGGGCAGTCAGCCGTCAGCGATCGGAAATCGTCCTGCCGCCCGAGGATTTTCAG
GGGGCAGTGGTTCTGGTCTGCGGGGATACCGACGGTCTGTTTCCCGGGCGTTCGGCGCACGGCGAAACCC
GTCACGGCTGGTATCTCCGGGGTGACAGCGCGGAGCAGTTGCCGCGGCTGGCGCAGTACCTGGCGGCGGC
GCGTCCGGCGCTGGTATCGCAGGTTTCCGTGCTGCTGGCGGTGGTACCGGAGCACCACCCCTCCGGGGAG
CATCTGGCGCAGTCGCTGCGCGACTGGCGGCGGAGTATCGTTCAGTGCCGAACCTGGCTAAACGGTCTGC
CGCCGGTGTGGAGCGTGTTCTGGGTGACGCCGCCAGGCGGCCAGGCCGCGGAAAGCCGCTGGTTTACCAT
CACGCCGGAGAGGGCTGGTCTCCAGGCGCAGCAGAAGGGACAAGCGCCCCAGGCGGTTGCCGGGTGGCAG
CGGGAGGGCAGCTCTGCCTCACGCCTGCATCAGACGCTGTGGCTGGAGAGCATTCTGACCTTGGCCGAAA
ACGCTCTTTTCCGGCCATTCCGCGCCCGGCAGGCAGAACTTCCTCCGCTGAACCTGTGTGCCGCGGGCAT
CTGCCTGACACCGGTAGCGGCGGTGGCGAATAACCTCTGGCAACAGCAAATCGCCGGGATCACCACGCTC
TCCCCGGGCAACGACGCGGCGCCAGGTCCTCACCCGCTGCCGGATCTTCTTCTGTCGTCACTGCCGCACC
GCCACGGGGTCAGCCGCCGGATGCGCGATGCCGGTCTTGCCGCTGGGGTGGGCTTCCTCTTTCTGGCGCT
GGCGATGCTGGCTTCCTTTATCAACAACCAGCGCCTGGTGCGCAGCGTCGGCGATCATCTGGCGGTGTAT
CACCGCCTCAGCGGCACGCCGCCGACGCCGAAGCTGCAGGCGCAGCAGCGTCTGCGTGCCGACAGCCGCC
TGCTGGATGACTGGTTGCGCCGGGGGGAGCCGCTGCGTTATCGGCTGGGGCTGTATCAGGGGGGGCGGCT
GATCCCCTTCGTGGAAGCCGCTATCAATGACTGGGCGCCGCCCCCGCCGCCGCGTCCGGTCATCAAGCAG
GTTGTGCAGGGGCCGCAGACGATCCGCCTCGATAGCATGGCGCTGTTCGATACCGGCAAATCGACGCTGA
AACCGGGTTCGACAAAGCTGCTGGTGAACTCGCTGCTGGGCATTAAGGCCAAACCCGGCTGGCTGATCGT
GGTGGCAGGCCATACCGACAGCATCGGCAACGATAAATCCAATCAACAACTCTCCCTGAAGCGTGCCGAG
GCGGTCCGCGACTGGATGCGCGATACCGGCGATGTGCCGGTGAGCTGTTTTGCGGTGCAGGGCTACGGCG
CAAGCCGTCCTGTCGCCAGCAACGAGACGCCAGAGGGGCGGGCGCAAAATCGCCGGGTGGAGATCAGTCT
GGTCCCGCAGAAGGACGCCTGTCTGACGCCGGGCACGGCCAATACCTCAGGAGCAGAGACTAACGGATTA
AAAAGCGAAACCGAGTAA