SecReT6
Protein ID: 530629742
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2004
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2056558..2058666 [+]
Producthypothetical protein
NoteTssI
UniProt IDS5YMM0
KEGG IDkpj:N559_2004
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 4.90E-55, Aligned region: 479..633
Phage_GPD [PF05954], Evalue: 4.40E-41, Aligned region: 2..229
T6SS_Vgr [PF13296], Evalue: 3.50E-33, Aligned region: 361..467
Phage_base_V [PF04717], Evalue: 1.10E-15, Aligned region: 261..356
Protein Sequence: 702 a.a.     [Download]
>gi|530629742|ref|YP_008425010.1| hypothetical protein N559_2004 [Klebsiella pneumoniae JM45]
MPEVVEQVLQEHHLHDWEYEFNLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHF
ADAQRALMFDKTLPVNSPSGMSDSGAESIWGLSITHNVVEANVTTRDYNPRDAQSVLQSATADMTRGNGE
GITYGEVYHYKLRHRERGDKIDPQTETANFYARLDHERFLAHQTLITAISTAAWLAPAQVLTVTDSLPST
LPAPVQDPLLITGTGFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQD
ASGLYRVKFDADREEKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSR
HVDPVTEKNSTRNVIRTPANNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVNAQRELRGEGAELRTDKW
VSIRGGAGVFISADKQPSAGDRMLAMEEAIAQLENALGIAKSLASAAESAQALPSDTGNQQTLNDALKEL
AQPGIVLNAPQGVSISSPQAVRLSSGSACVGIVSQQNTDISALKRFTVAAGEAVSLLARKAGMKLFAAKG
KIEIQAQDDALEATAKKDITVTSVEGRVEITAAEELVVNCAGAYIRLSGGNIELGCPGNILLKSANVQKM
GKADFRVPPLELPEGFEERFTVKDQKTGDIVPFARYRITTEKGQVFEGRADADGKTASVYTALPESIKIE
LL
 
Nucleotide Sequence: 2109 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2056558-2058666 Klebsiella pneumoniae JM45, complete genome
GTGCCGGAGGTGGTGGAGCAGGTATTGCAGGAACATCACCTGCATGACTGGGAGTATGAGTTTAATCTCA
AGCAACACTATCCGCGGCGCGAGCAAATTAATCAGTATCAGGAGAGCGACCTGGCATTTATCCAGCGCCT
GCTGGCAGAGGTGGGGATATTTTATTTCTTCACCCTGCAGGAAGAGGCGCAGAGCGAAGTGGTTCACTTC
GCCGACGCGCAGCGGGCGCTGATGTTCGATAAAACACTTCCTGTAAACAGCCCGTCCGGGATGAGCGACA
GCGGTGCGGAATCGATATGGGGTCTGAGCATCACCCACAACGTCGTAGAGGCGAACGTCACTACCCGGGA
TTATAACCCCCGCGATGCGCAGAGCGTTCTCCAGTCGGCAACAGCGGATATGACCCGGGGAAATGGTGAA
GGCATCACTTACGGTGAGGTATACCACTATAAGCTTCGCCACCGGGAGCGTGGCGATAAAATCGACCCGC
AGACGGAGACCGCCAACTTCTATGCCCGCCTCGACCATGAGCGTTTTCTGGCTCACCAGACGCTTATTAC
CGCGATCAGTACTGCAGCCTGGCTGGCGCCGGCCCAGGTGCTGACCGTTACCGACAGTCTGCCGTCGACC
CTGCCTGCGCCCGTACAGGATCCGCTGTTAATCACCGGCACCGGTTTTACCGCCAGCCGCCGGGAGGCGC
TGCGGGTGTCCCTGCTGGCGGTGCCCTACAGCGAAACATTGTGCTGGCGTCCGCCGCTGCTGCCGCGCCC
GAAGGTGACTGGCACCATGACGGCGCGGGTGACCAGCGCGAAAGCGAATGATATCTACGCTTGGCAGGAT
GCGTCCGGCCTGTACCGGGTGAAATTTGACGCTGACAGAGAGGAGAAAGGGCAGGGTCAGGAAAGCATGC
CGGTGCGTCTCGCCAAACCCTACGGCGGCGACGTGTACGGTTTTCACTTCCCGCTGATCCAGGGCACGGA
GGTGGCGATTGCTTTCCACGAAGGCGACCCTGACCGGCCGTATATTGCGCATGCGCTGCACGACTCGCGG
CATGTCGATCCTGTGACGGAGAAAAACAGCACCCGCAATGTGATTCGTACTCCGGCCAATAATAAGCTGC
GAATGGAGGACAAGCGCGGCGAGGAGCATATCAAGCTCAGCACCGAGTACGGCGGCAAGACGCAGCTGAA
CCTGGGGCATAACGTGAATGCGCAAAGGGAGTTGCGGGGCGAGGGTGCGGAACTGCGTACGGATAAATGG
GTGAGCATCCGGGGCGGTGCGGGAGTGTTTATCAGTGCGGATAAACAGCCTTCGGCAGGCGACAGGATGC
TGGCAATGGAGGAGGCGATTGCGCAGCTTGAAAATGCCCTGGGTATTGCGAAAAGCCTGGCGTCGGCAGC
GGAATCGGCTCAGGCCCTGCCATCGGATACCGGCAACCAGCAGACGCTGAACGATGCGCTGAAAGAGCTG
GCGCAGCCGGGGATAGTGCTGAATGCGCCGCAGGGCGTGAGCATCAGCAGTCCGCAGGCGGTACGGTTGT
CTTCGGGTAGCGCCTGCGTGGGGATTGTATCACAGCAGAATACGGACATTAGTGCGCTGAAACGTTTTAC
GGTGGCGGCGGGAGAAGCCGTCAGCCTGCTGGCGCGAAAGGCGGGGATGAAGCTGTTTGCGGCGAAGGGA
AAGATTGAAATCCAGGCGCAGGATGATGCGCTGGAGGCGACGGCGAAAAAGGATATCACCGTGACCAGCG
TGGAAGGGCGAGTGGAAATCACGGCGGCGGAGGAACTGGTGGTGAATTGTGCGGGAGCGTATATCAGGCT
AAGTGGTGGCAATATCGAGCTGGGCTGCCCTGGGAATATTCTGCTGAAATCGGCCAATGTGCAGAAAATG
GGTAAGGCGGATTTTCGGGTGCCTCCGCTGGAACTGCCTGAAGGGTTCGAAGAGCGTTTTACTGTCAAAG
ATCAAAAGACCGGTGACATTGTGCCATTTGCCCGTTACCGCATCACCACTGAAAAAGGCCAGGTATTCGA
AGGCCGGGCAGATGCTGATGGGAAAACGGCCAGCGTTTATACCGCATTGCCTGAATCAATAAAAATAGAG
CTACTGTGA