SecReT6
Protein ID: 530629760
SecReT6 ID840
T6SS typeN/A
Gene symbol-
Locus tagN559_2022
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2071632..2071898 [+]
Producthypothetical protein
NotePAAR
UniProt IDS5YUS6
KEGG IDkpj:N559_2022
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.60E-23, Aligned region: 9..81
Protein Sequence: 88 a.a.     [Download]
>gi|530629760|ref|YP_008425028.1| hypothetical protein N559_2022 [Klebsiella pneumoniae JM45]
MSKGFVLLGDKTTHGGAVISASSTMIVNGKPVALVGDKVSCPIPGHGTNAIIEGAPEWSSDGKAIVVDGC
KCQCGCQVISGAPECAIG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|530627845|ref|NC_022082.1|:2071632-2071898 Klebsiella pneumoniae JM45, complete genome
ATGTCCAAAGGTTTTGTATTACTCGGCGATAAAACCACGCACGGCGGTGCTGTTATTTCCGCATCCTCCA
CCATGATTGTAAATGGAAAGCCCGTAGCGCTGGTGGGGGATAAAGTCAGCTGCCCGATTCCGGGACATGG
CACTAATGCCATTATTGAGGGAGCGCCGGAATGGTCTTCCGATGGTAAAGCCATCGTGGTCGATGGCTGC
AAATGTCAGTGCGGTTGCCAGGTGATTTCCGGCGCGCCGGAATGCGCGATAGGATAA